INSL3 (NM_005543) Human Mass Spec Standard

CAT#: PH309944

INSL3 MS Standard C13 and N15-labeled recombinant protein (NP_005534)

Product Images

Coomassie blue staining of purified INSL3 protein (Cat# TP309944). The protein was produced from HEK293T cells transfected with INSL3 cDNA clone (Cat# RC209944) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC209944
• Predicted MW: 14.5 kDa
• Protein Sequence:
  Sequence Link

  >RC209944 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MDPRLPAWALVLLGPALVFALGPAPTPEMREKLCGHHFVRALVRVCGGPRWSTEARRPAAGGDRELLQWL
  ERRHLLHGLVADSNLTLGPGLQPLPQTSHHHRHHRAAATNPARYCCLSGCTQQDLLTLCPY
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_005534
• RefSeq Size: 833
• RefSeq ORF: 393
• Synonyms: ley-I-L; RLF; RLNL
• Locus ID: 3640
• UniProt ID: P51460
• Cytogenetics: 19p13.11
• Summary: 'This gene encodes a member of the insulin-like hormone superfamily. The encoded protein is mainly produced in gonadal tissues. Studies of the mouse counterpart suggest that this gene may be involved in the development of urogenital tract and female fertility. This protein may also act as a hormone to regulate growth and differentiation of gubernaculum, and thus mediating intra-abdominal testicular descent. Mutations in this gene may lead to cryptorchidism. Alternate splicing results in multiple transcript variants. [provided by RefSeq, May 2012]'
• Protein Families: Druggable Genome, Secreted Protein