AK2 (NM_001625) Human Mass Spec Standard
CAT#: PH309974
AK2 MS Standard C13 and N15-labeled recombinant protein (NP_001616)
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC209974 |
Predicted MW | 26.5 kDa |
Protein Sequence |
>RC209974 protein sequence
Red=Cloning site Green=Tags(s) MAPSVPAAEPEYPKGIRAVLLGPPGAGKGTQAPRLAENFCVCHLATGDMLRAMVASGSELGKKLKATMDA GKLVSDEMVVELIEKNLETPLCKNGFLLDGFPRTVRQAEMLDDLMEKRKEKLDSVIEFSIPDSLLIRRIT GRLIHPKSGRSYHEEFNPPKEPMKDDITGEPLIRRSDDNEKALKIRLQAYHTQTTPLIEYYRKRGIHSAI DASQTPDVVFASILAAFSKATCKDLVMFI myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | 50 ug/ml as determined by BCA |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_001616 |
RefSeq Size | 2759 |
RefSeq ORF | 717 |
Synonyms | ADK2 |
Locus ID | 204 |
UniProt ID | P54819, A0A140VK93 |
Cytogenetics | 1p35.1 |
Summary | 'Adenylate kinases are involved in regulating the adenine nucleotide composition within a cell by catalyzing the reversible transfer of phosphate groups among adenine nucleotides. Three isozymes of adenylate kinase, namely 1, 2, and 3, have been identified in vertebrates; this gene encodes isozyme 2. Expression of these isozymes is tissue-specific and developmentally regulated. Isozyme 2 is localized in the mitochondrial intermembrane space and may play a role in apoptosis. Mutations in this gene are the cause of reticular dysgenesis. Alternate splicing results in multiple transcript variants. Pseudogenes of this gene are found on chromosomes 1 and 2.[provided by RefSeq, Nov 2010]' |
Protein Families | Druggable Genome |
Protein Pathways | Metabolic pathways, Purine metabolism |
Documents
FAQs |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC415600 | AK2 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 99.00 |
|
LC419835 | AK2 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 99.00 |
|
LC429382 | AK2 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 99.00 |
|
LY415600 | Transient overexpression lysate of adenylate kinase 2 (AK2), transcript variant AK2B |
USD 325.00 |
|
LY419835 | Transient overexpression lysate of adenylate kinase 2 (AK2), transcript variant AK2A |
USD 325.00 |
|
LY429382 | Transient overexpression lysate of adenylate kinase 2 (AK2), transcript variant AK2B |
USD 325.00 |
|
TP309974 | Recombinant protein of human adenylate kinase 2 (AK2), transcript variant AK2A |
USD 823.00 |
{0} Product Review(s)
Be the first one to submit a review