AK2 (NM_001625) Human Mass Spec Standard

CAT#: PH309974

AK2 MS Standard C13 and N15-labeled recombinant protein (NP_001616)

Product Images

Coomassie blue staining of purified AK2 protein (Cat# TP309974). The protein was produced from HEK293T cells transfected with AK2 cDNA clone (Cat# RC209974) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC209974
• Predicted MW: 26.5 kDa
• Protein Sequence:
  Sequence Link

  >RC209974 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MAPSVPAAEPEYPKGIRAVLLGPPGAGKGTQAPRLAENFCVCHLATGDMLRAMVASGSELGKKLKATMDA
  GKLVSDEMVVELIEKNLETPLCKNGFLLDGFPRTVRQAEMLDDLMEKRKEKLDSVIEFSIPDSLLIRRIT
  GRLIHPKSGRSYHEEFNPPKEPMKDDITGEPLIRRSDDNEKALKIRLQAYHTQTTPLIEYYRKRGIHSAI
  DASQTPDVVFASILAAFSKATCKDLVMFI
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_001616
• RefSeq Size: 2759
• RefSeq ORF: 717
• Synonyms: ADK2
• Locus ID: 204
• UniProt ID: P54819, A0A140VK93
• Cytogenetics: 1p35.1
• Summary: 'Adenylate kinases are involved in regulating the adenine nucleotide composition within a cell by catalyzing the reversible transfer of phosphate groups among adenine nucleotides. Three isozymes of adenylate kinase, namely 1, 2, and 3, have been identified in vertebrates; this gene encodes isozyme 2. Expression of these isozymes is tissue-specific and developmentally regulated. Isozyme 2 is localized in the mitochondrial intermembrane space and may play a role in apoptosis. Mutations in this gene are the cause of reticular dysgenesis. Alternate splicing results in multiple transcript variants. Pseudogenes of this gene are found on chromosomes 1 and 2.[provided by RefSeq, Nov 2010]'
• Protein Families: Druggable Genome
• Protein Pathways: Metabolic pathways, Purine metabolism