NUP50 (NM_007172) Human Mass Spec Standard
CAT#: PH309975
NUP50 MS Standard C13 and N15-labeled recombinant protein (NP_009103)
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC209975 |
Predicted MW | 50.1 kDa |
Protein Sequence |
>RC209975 protein sequence
Red=Cloning site Green=Tags(s) MAKRNAEKELTDRNWDQEDEAEEVGTFSMASEEVLKNRAIKKAKRRNVGFESDTGGAFKGFKGLVVPSGG GRFSGFGSGAGGKPLEGLSNGNNITSAPPFASAKAAADPKVAFGSLAANGPTTLVDKVSNPKTNGDSQQP SSSGLASSKACVGNAYHKQLAALNCSVRDWIVKHVNTNPLCDLTPIFKDYEKYLANIEQQHGNSGRNSES ESNKVAAETQSPSLFGSTKLQQESTFLFHGNKTEDTPDKKMEVASEKKTDPSSLGATSASFNFGKKVDSS VLGSLSSVPLTGFSFSPGNSSLFGKDTTQSKPVSSPFPTKPLEGQAEGDSGECKGGDEEENDEPPKVVVT EVKEEDAFYSKKCKLFYKKDNEFKEKGIGTLHLKPTANQKTQLLVRADTNLGNILLNVLIPPNMPCTRTG KNNVLIVCVPNPPIDEKNATMPVTMLIRVKTSEDADELHKILLEKKDA myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | 50 ug/ml as determined by BCA |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_009103 |
RefSeq Size | 5225 |
RefSeq ORF | 1404 |
Synonyms | NPAP60; NPAP60L |
Locus ID | 10762 |
UniProt ID | Q9UKX7, A0A024R4X7 |
Cytogenetics | 22q13.31 |
Summary | The nuclear pore complex is a massive structure that extends across the nuclear envelope, forming a gateway that regulates the flow of macromolecules between the nucleus and the cytoplasm. Nucleoporins are the main components of the nuclear pore complex in eukaryotic cells. The protein encoded by this gene is a member of the FG-repeat containing nucleoporins that functions as a soluble cofactor in importin-alpha:beta-mediated nuclear protein import. Pseudogenes of this gene are found on chromosomes 5, 6, and 14. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jul 2008] |
Protein Families | Stem cell - Pluripotency |
Documents
FAQs |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC407000 | NUP50 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LC416145 | NUP50 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LC430280 | NUP50 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LY407000 | Transient overexpression lysate of nucleoporin 50kDa (NUP50), transcript variant 3 |
USD 396.00 |
|
LY416145 | Transient overexpression lysate of nucleoporin 50kDa (NUP50), transcript variant 2 |
USD 396.00 |
|
LY430280 | Transient overexpression lysate of nucleoporin 50kDa (NUP50), transcript variant 3 |
USD 396.00 |
|
PH307001 | NUP50 MS Standard C13 and N15-labeled recombinant protein (NP_705931) |
USD 2,055.00 |
|
TP307001 | Recombinant protein of human nucleoporin 50kDa (NUP50), transcript variant 3 |
USD 823.00 |
|
TP309975 | Recombinant protein of human nucleoporin 50kDa (NUP50), transcript variant 2 |
USD 823.00 |
{0} Product Review(s)
Be the first one to submit a review