IL22 (NM_020525) Human Mass Spec Standard

CAT#: PH309995

IL22 MS Standard C13 and N15-labeled recombinant protein (NP_065386)

Product Images

Coomassie blue staining of purified IL22 protein (Cat# TP309995). The protein was produced from HEK293T cells transfected with IL22 cDNA clone (Cat# RC209995) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC209995
• Predicted MW: 20 kDa
• Protein Sequence:
  Sequence Link

  >RC209995 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MAALQKSVSSFLMGTLATSCLLLLALLVQGGAAAPISSHCRLDKSNFQQPYITNRTFMLAKEASLADNNT
  DVRLIGEKLFHGVSMSERCYLMKQVLNFTLEEVLFPQSDRFQPYMQEVVPFLARLSNRLSTCHIEGDDLH
  IQRNVQKLKDTVKKLGESGEIKAIGELDLLFMSLRNACI
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_065386
• RefSeq Size: 1147
• RefSeq ORF: 537
• Synonyms: IL-21; IL-22; IL-D110; IL-TIF; ILTIF; TIFa; TIFIL-23; zcyto18
• Locus ID: 50616
• UniProt ID: Q9GZX6
• Cytogenetics: 12q15
• Summary: This gene is a member of the IL10 family of cytokines that mediate cellular inflammatory responses. The encoded protein functions in antimicrobial defense at mucosal surfaces and in tissue repair. This protein also has pro-inflammatory properties and plays a role in in the pathogenesis of several intestinal diseases. [provided by RefSeq, Jul 2018]
• Protein Families: Druggable Genome, Secreted Protein, Transmembrane
• Protein Pathways: Cytokine-cytokine receptor interaction, Jak-STAT signaling pathway