S100A12 (NM_005621) Human Mass Spec Standard
CAT#: PH310002
S100A12 MS Standard C13 and N15-labeled recombinant protein (NP_005612)
Specifications
| Product Data | |
| Tag | C-Myc/DDK |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC210002 |
| Predicted MW | 10.6 kDa |
| Protein Sequence |
>RC210002 protein sequence
Red=Cloning site Green=Tags(s) MTKLEEHLEGIVNIFHQYSVRKGHFDTLSKGELKQLLTKELANTIKNIKDKAVIDEIFQGLDANQDEQVD FQEFISLVAIALKAAHYHTHKE myc-FLAG tag |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | 50 ug/ml as determined by BCA |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions. |
| Reference Data | |
| RefSeq | NP_005612 |
| RefSeq Size | 466 |
| RefSeq ORF | 276 |
| Synonyms | CAAF1; CAGC; CGRP; ENRAGE; MRP-6; MRP6; p6 |
| Locus ID | 6283 |
| UniProt ID | P80511 |
| Cytogenetics | 1q21.3 |
| Summary | 'The protein encoded by this gene is a member of the S100 family of proteins containing 2 EF-hand calcium-binding motifs. S100 proteins are localized in the cytoplasm and/or nucleus of a wide range of cells, and involved in the regulation of a number of cellular processes such as cell cycle progression and differentiation. S100 genes include at least 13 members which are located as a cluster on chromosome 1q21. This protein is proposed to be involved in specific calcium-dependent signal transduction pathways and its regulatory effect on cytoskeletal components may modulate various neutrophil activities. The protein includes an antimicrobial peptide which has antibacterial activity. [provided by RefSeq, Nov 2014]' |
Documents
| FAQs |
Resources
Recombinant Protein Resources |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC401723 | S100A12 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
| LY401723 | Transient overexpression lysate of S100 calcium binding protein A12 (S100A12) |
USD 436.00 |
|
| TP310002 | Recombinant protein of human S100 calcium binding protein A12 (S100A12) |
USD 823.00 |
{0} Product Review(s)
Be the first one to submit a review
Germany
Japan
United Kingdom
China