IL2 (NM_000586) Human Mass Spec Standard
CAT#: PH310013
IL2 MS Standard C13 and N15-labeled recombinant protein (NP_000577)
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC210013 |
Predicted MW | 17.6 kDa |
Protein Sequence |
>RC210013 protein sequence
Red=Cloning site Green=Tags(s) MYRMQLLSCIALSLALVTNSAPTSSSTKKTQLQLEHLLLDLQMILNGINNYKNPKLTRMLTFKFYMPKKA TELKHLQCLEEELKPLEEVLNLAQSKNFHLRPRDLISNINVIVLELKGSETTFMCEYADETATIVEFLNR WITFCQSIISTLT myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | 50 ug/ml as determined by BCA |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_000577 |
RefSeq Size | 822 |
RefSeq ORF | 459 |
Synonyms | IL-2; lymphokine; TCGF |
Locus ID | 3558 |
UniProt ID | P60568, Q0GK43 |
Cytogenetics | 4q27 |
Summary | 'This gene is a member of the interleukin 2 (IL2) cytokine subfamily which includes IL4, IL7, IL9, IL15, IL21, erythropoietin, and thrombopoietin. The protein encoded by this gene is a secreted cytokine produced by activated CD4+ and CD8+ T lymphocytes, that is important for the proliferation of T and B lymphocytes. The receptor of this cytokine (IL2R) is a heterotrimeric protein complex whose gamma chain is also shared by IL4 and IL7. The expression of this gene in mature thymocytes is monoallelic, which represents an unusual regulatory mode for controlling the precise expression of a single gene. The targeted disruption of a similar gene in mice leads to ulcerative colitis-like disease, which suggests an essential role of this gene in the immune response to antigenic stimuli. [provided by RefSeq, Sep 2020]' |
Protein Families | Druggable Genome, Secreted Protein |
Protein Pathways | Allograft rejection, Autoimmune thyroid disease, Cytokine-cytokine receptor interaction, Graft-versus-host disease, Jak-STAT signaling pathway, T cell receptor signaling pathway, Type I diabetes mellitus |
Documents
FAQs |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC424619 | IL2 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 99.00 |
|
LY424619 | Transient overexpression lysate of interleukin 2 (IL2) |
USD 325.00 |
|
TP310013 | Recombinant protein of human interleukin 2 (IL2) |
USD 439.00 |
|
TP720012 | Recombinant protein of human interleukin 2 (IL2), Pro22-Thr153 |
USD 300.00 |
|
TP723213 | Purified recombinant protein of Human interleukin 2 (IL2). |
USD 240.00 |
|
TP723850 | Purified recombinant protein of Human interleukin 2 (IL2) |
USD 205.00 |
|
TP750020 | Purified recombinant protein of Homo sapiens Interleukin 2 (IL-2) produced in E. coli. |
USD 425.00 |
|
TP790117 | Purified recombinant protein of Human interleukin 2 (IL2), Tag free, secretory expressed in CHO cells, 100ug |
USD 425.00 |
{0} Product Review(s)
Be the first one to submit a review