PYCR1 (NM_006907) Human Mass Spec Standard
CAT#: PH310027
PYCR1 MS Standard C13 and N15-labeled recombinant protein (NP_008838)
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC210027 |
Predicted MW | 33.2 kDa |
Protein Sequence |
>RC210027 representing NM_006907
Red=Cloning site Green=Tags(s) MSVGFIGAGQLAFALAKGFTAAGVLAAHKIMASSPDMDLATVSALRKMGVKLTPHNKETVQHSDVLFLAV KPHIIPFILDEIGADIEDRHIVVSCAAGVTISSIEKKLSAFRPAPRVIRCMTNTPVVVREGATVYATGTH AQVEDGRLMEQLLSSVGFCTEVEEDLIDAVTGLSGSGPAYAFTALDALADGGVKMGLPRRLAVRLGAQAL LGAAKMLLHSEQHPGQLKDNVSSPGGATIHALHVLESGGFRSLLINAVEASCIRTRELQSMADQEQVSPA AIKKTILDKVKLDSPAGTALSPSGHTKLLPRSLAPAGKD myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | 50 ug/ml as determined by BCA |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_008838 |
RefSeq Size | 2059 |
RefSeq ORF | 957 |
Synonyms | ARCL2B; ARCL3B; P5C; P5CR; PIG45; PP222; PRO3; PYCR |
Locus ID | 5831 |
UniProt ID | P32322, A0A024R8U9, Q8TBX0 |
Cytogenetics | 17q25.3 |
Summary | 'This gene encodes an enzyme that catalyzes the NAD(P)H-dependent conversion of pyrroline-5-carboxylate to proline. This enzyme may also play a physiologic role in the generation of NADP(+) in some cell types. The protein forms a homopolymer and localizes to the mitochondrion. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Aug 2013]' |
Protein Pathways | Arginine and proline metabolism, Metabolic pathways |
Documents
FAQs |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC406968 | PYCR1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LC416328 | PYCR1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LY406968 | Transient overexpression lysate of pyrroline-5-carboxylate reductase 1 (PYCR1), transcript variant 2 |
USD 396.00 |
|
LY416328 | Transient overexpression lysate of pyrroline-5-carboxylate reductase 1 (PYCR1), transcript variant 1 |
USD 396.00 |
|
PH316359 | PYCR1 MS Standard C13 and N15-labeled recombinant protein (NP_722546) |
USD 2,055.00 |
|
TP310027 | Recombinant protein of human pyrroline-5-carboxylate reductase 1 (PYCR1), transcript variant 1 |
USD 823.00 |
|
TP316359 | Recombinant protein of human pyrroline-5-carboxylate reductase 1 (PYCR1), transcript variant 2 |
USD 748.00 |
{0} Product Review(s)
Be the first one to submit a review