PYCR1 (NM_153824) Human Mass Spec Standard

CAT#: PH316359

PYCR1 MS Standard C13 and N15-labeled recombinant protein (NP_722546)

Product Images

Coomassie blue staining of purified PYCR1 protein (Cat# TP316359). The protein was produced from HEK293T cells transfected with PYCR1 cDNA clone (Cat# RC216359) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC216359
• Predicted MW: 33.2 kDa
• Protein Sequence:
  Sequence Link

  >RC216359 representing NM_153824
  Red=Cloning site Green=Tags(s)
  
  MSVGFIGAGQLAFALAKGFTAAGVLAAHKIMASSPDMDLATVSALRKMGVKLTPHNKETVQHSDVLFLAV
  KPHIIPFILDEIGADIEDRHIVVSCAAGVTISSIEKKLSAFRPAPRVIRCMTNTPVVVREGATVYATGTH
  AQVEDGRLMEQLLSSVGFCTEVEEDLIDAVTGLSGSGPAYAFTALDALADGGVKMGLPRRLAVRLGAQAL
  LGAAKMLLHSEQHPGQLKDNVSSPGGATIHALHVLESGGFRSLLINAVEASCIRTRELQSMADQEQVSPA
  AIKKTILDKDHLPLELGSPEGLHPLLLQYQLARAPS
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_722546
• RefSeq Size: 1768
• RefSeq ORF: 948
• Synonyms: ARCL2B; ARCL3B; P5C; P5CR; PIG45; PP222; PRO3; PYCR
• Locus ID: 5831
• UniProt ID: P32322, Q8TBX0
• Cytogenetics: 17q25.3
• Summary: 'This gene encodes an enzyme that catalyzes the NAD(P)H-dependent conversion of pyrroline-5-carboxylate to proline. This enzyme may also play a physiologic role in the generation of NADP(+) in some cell types. The protein forms a homopolymer and localizes to the mitochondrion. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Aug 2013]'
• Protein Pathways: Arginine and proline metabolism, Metabolic pathways