PSMD4 (NM_002810) Human Mass Spec Standard
CAT#: PH310046
PSMD4 MS Standard C13 and N15-labeled recombinant protein (NP_002801)
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC210046 |
Predicted MW | 40.7 kDa |
Protein Sequence |
>RC210046 protein sequence
Red=Cloning site Green=Tags(s) MVLESTMVCVDNSEYMRNGDFLPTRLQAQQDAVNIVCHSKTRSNPENNVGLITLANDCEVLTTLTPDTGR ILSKLHTVQPKGKITFCTGIRVAHLALKHRQGKNHKMRIIAFVGSPVEDNEKDLVKLAKRLKKEKVNVDI INFGEEEVNTEKLTAFVNTLNGKDGTGSHLVTVPPGPSLADALISSPILAGEGGAMLGLGASDFEFGVDP SADPELALALRVSMEEQRQRQEEEARRAAAASAAEAGIATTGTEDSDDALLKMTISQQEFGRTGLPDLSS MTEEEQIAYAMQMSLQGAEFGQAESADIDASSAMDTSEPAKEEDDYDVMQDPEFLQSVLENLPGVDPNNE AIRNAMGSLASQATKDGKKDKKEEDKK myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | 50 ug/ml as determined by BCA |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_002801 |
RefSeq Size | 1332 |
RefSeq ORF | 1131 |
Synonyms | AF; AF-1; ASF; MCB1; pUB-R5; Rpn10; S5A |
Locus ID | 5710 |
UniProt ID | P55036 |
Cytogenetics | 1q21.3 |
Summary | 'The 26S proteasome is a multicatalytic proteinase complex with a highly ordered structure composed of 2 complexes, a 20S core and a 19S regulator. The 20S core is composed of 4 rings of 28 non-identical subunits; 2 rings are composed of 7 alpha subunits and 2 rings are composed of 7 beta subunits. The 19S regulator is composed of a base, which contains 6 ATPase subunits and 2 non-ATPase subunits, and a lid, which contains up to 10 non-ATPase subunits. Proteasomes are distributed throughout eukaryotic cells at a high concentration and cleave peptides in an ATP/ubiquitin-dependent process in a non-lysosomal pathway. An essential function of a modified proteasome, the immunoproteasome, is the processing of class I MHC peptides. This gene encodes one of the non-ATPase subunits of the 19S regulator lid. Pseudogenes have been identified on chromosomes 10 and 21. [provided by RefSeq, Jul 2008]' |
Protein Pathways | Proteasome |
Documents
FAQs |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC400997 | PSMD4 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 99.00 |
|
LY400997 | Transient overexpression lysate of proteasome (prosome, macropain) 26S subunit, non-ATPase, 4 (PSMD4) |
USD 325.00 |
|
TP310046 | Recombinant protein of human proteasome (prosome, macropain) 26S subunit, non-ATPase, 4 (PSMD4) |
USD 823.00 |
|
TP760263 | Recombinant protein of human proteasome (prosome, macropain) 26S subunit, non-ATPase, 4 (PSMD4), full length, with N-terminal HIS tag, expressed in E.Coli, 50ug |
USD 215.00 |
{0} Product Review(s)
Be the first one to submit a review