Galectin 7 (LGALS7) (NM_002307) Human Mass Spec Standard

CAT#: PH310052

LGALS7 MS Standard C13 and N15-labeled recombinant protein (NP_002298)

Product Images

Coomassie blue staining of purified LGALS7 protein (Cat# TP310052). The protein was produced from HEK293T cells transfected with LGALS7 cDNA clone (Cat# RC210052) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC210052
• Predicted MW: 14.9 kDa
• Protein Sequence:
  Sequence Link

  >RC210052 representing NM_002307
  Red=Cloning site Green=Tags(s)
  
  MSNVPHKSSLPEGIRPGTVLRIRGLVPPNASRFHVNLLCGEEQGSDAALHFNPRLDTSEVVFNSKEQGSW
  GREERGPGVPFQRGQPFEVLIIASDDGFKAVVGDAQYHHFRHRLPLARVRLVEVGGDVQLDSVRIF
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_002298
• RefSeq Size: 498
• RefSeq ORF: 408
• Synonyms: GAL7; LGALS7A
• Locus ID: 3963
• UniProt ID: P47929
• Cytogenetics: 19q13.2
• Summary: 'The galectins are a family of beta-galactoside-binding proteins implicated in modulating cell-cell and cell-matrix interactions. Differential and in situ hybridization studies indicate that this lectin is specifically expressed in keratinocytes and found mainly in stratified squamous epithelium. A duplicate copy of this gene (GeneID:653499) is found adjacent to, but on the opposite strand on chromosome 19. [provided by RefSeq, Jul 2008]'
• Protein Families: Secreted Protein