MOX1 (MEOX1) (NM_004527) Human Mass Spec Standard

CAT#: PH310106

MEOX1 MS Standard C13 and N15-labeled recombinant protein (NP_004518)

Product Images

Coomassie blue staining of purified MEOX1 protein (Cat# TP310106). The protein was produced from HEK293T cells transfected with MEOX1 cDNA clone (Cat# RC210106) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC210106
• Predicted MW: 28 kDa
• Protein Sequence:
  Sequence Link

  >RC210106 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MDPAASSCMRSLQPPAPVWGCLRNPHSEGNGASGLPHYPPTPFSFHQKPDFLATATAAYPDFSASCLAAT
  PHSLPQEEHIFTEQHPAFPQSPNWHFPVSDARRRPNSGPAGGSKEMGTSSLGLVDTTGGPGDDYGVLGST
  ANETEKKSSRRRKESSDNQENRGKPEGSSKARKERTAFTKEQLRELEAEFAHHNYLTRLRRYEIAVNLDL
  SERQVKVWFQNRRMKWKRVKGGQPISPNGQDPEDGDSTASPSSE
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_004518
• RefSeq Size: 2330
• RefSeq ORF: 762
• Synonyms: KFS2; MOX1
• Locus ID: 4222
• UniProt ID: P50221
• Cytogenetics: 17q21.31
• Summary: 'This gene encodes a member of a subfamily of non-clustered, diverged, antennapedia-like homeobox-containing genes. The encoded protein may play a role in the molecular signaling network regulating somite development. Alternatively spliced transcript variants encoding different isoforms have been described. [provided by RefSeq, Jul 2008]'
• Protein Families: Transcription Factors