MOX1 (MEOX1) (NM_004527) Human Recombinant Protein
CAT#: TP310106
Recombinant protein of human mesenchyme homeobox 1 (MEOX1), transcript variant 1
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC210106 protein sequence
Red=Cloning site Green=Tags(s) MDPAASSCMRSLQPPAPVWGCLRNPHSEGNGASGLPHYPPTPFSFHQKPDFLATATAAYPDFSASCLAAT PHSLPQEEHIFTEQHPAFPQSPNWHFPVSDARRRPNSGPAGGSKEMGTSSLGLVDTTGGPGDDYGVLGST ANETEKKSSRRRKESSDNQENRGKPEGSSKARKERTAFTKEQLRELEAEFAHHNYLTRLRRYEIAVNLDL SERQVKVWFQNRRMKWKRVKGGQPISPNGQDPEDGDSTASPSSE myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 27.8 kDa |
Concentration | >50 ug/mL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_004518 |
Locus ID | 4222 |
UniProt ID | P50221 |
Cytogenetics | 17q21.31 |
Refseq Size | 2330 |
Refseq ORF | 762 |
Synonyms | KFS2; MOX1 |
Summary | This gene encodes a member of a subfamily of non-clustered, diverged, antennapedia-like homeobox-containing genes. The encoded protein may play a role in the molecular signaling network regulating somite development. Alternatively spliced transcript variants encoding different isoforms have been described. [provided by RefSeq, Jul 2008] |
Protein Families | Transcription Factors |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC417902 | MEOX1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LC421872 | MEOX1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LC425669 | MEOX1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LY417902 | Transient overexpression lysate of mesenchyme homeobox 1 (MEOX1), transcript variant 1 |
USD 396.00 |
|
LY421872 | Transient overexpression lysate of mesenchyme homeobox 1 (MEOX1), transcript variant 3 |
USD 396.00 |
|
LY425669 | Transient overexpression lysate of mesenchyme homeobox 1 (MEOX1), transcript variant 3 |
USD 396.00 |
|
PH310106 | MEOX1 MS Standard C13 and N15-labeled recombinant protein (NP_004518) |
USD 2,055.00 |
{0} Product Review(s)
Be the first one to submit a review