alpha 5 Defensin (DEFA5) (NM_021010) Human Mass Spec Standard

CAT#: PH310219

DEFA5 MS Standard C13 and N15-labeled recombinant protein (NP_066290)

Product Images

Coomassie blue staining of purified DEFA5 protein (Cat# TP310219). The protein was produced from HEK293T cells transfected with DEFA5 cDNA clone (Cat# RC210219) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC210219
• Predicted MW: 10.1 kDa
• Protein Sequence:
  Sequence Link

  >RC210219 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MRTIAILAAILLVALQAQAESLQERADEATTQKQSGEDNQDLAISFAGNGLSALRTSGSQARATCYCRTG
  RCATRESLSGVCEISGRLYRLCCR
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_066290
• RefSeq Size: 468
• RefSeq ORF: 282
• Synonyms: DEF5; HD-5
• Locus ID: 1670
• UniProt ID: Q01523
• Cytogenetics: 8p23.1
• Summary: 'Defensins are a family of antimicrobial and cytotoxic peptides thought to be involved in host defense. They are abundant in the granules of neutrophils and also found in the epithelia of mucosal surfaces such as those of the intestine, respiratory tract, urinary tract, and vagina. Members of the defensin family are highly similar in protein sequence and distinguished by a conserved cysteine motif. Several of the alpha defensin genes appear to be clustered on chromosome 8. The protein encoded by this gene, defensin, alpha 5, is highly expressed in the secretory granules of Paneth cells of the ileum. [provided by RefSeq, Oct 2014]'
• Protein Families: Secreted Protein