GPA33 (NM_005814) Human Mass Spec Standard

CAT#: PH310225

GPA33 MS Standard C13 and N15-labeled recombinant protein (NP_005805)

Product Images

Coomassie blue staining of purified GPA33 protein (Cat# TP310225). The protein was produced from HEK293T cells transfected with GPA33 cDNA clone (Cat# RC210225) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC210225
• Predicted MW: 35.6 kDa
• Protein Sequence:
  Sequence Link

  >RC210225 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MVGKMWPVLWTLCAVRVTVDAISVETPQDVLRASQGKSVTLPCTYHTSTSSREGLIQWDKLLLTHTERVV
  IWPFSNKNYIHGELYKNRVSISNNAEQSDASITIDQLTMADNGTYECSVSLMSDLEGNTKSRVRLLVLVP
  PSKPECGIEGETIIGNNIQLTCQSKEGSPTPQYSWKRYNILNQEQPLAQPASGQPVSLKNISTDTSGYYI
  CTSSNEEGTQFCNITVAVRSPSMNVALYVGIAVGVVAALIIIGIIIYCCCCRGKDDNTEDKEDARPNREA
  YEEPPEQLRELSREREEEDDYRQEEQRSTGRESPDHLDQ
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_005805
• RefSeq Size: 2793
• RefSeq ORF: 957
• Synonyms: A33
• Locus ID: 10223
• UniProt ID: Q99795
• Cytogenetics: 1q24.1
• Summary: The glycoprotein encoded by this gene is a cell surface antigen that is expressed in greater than 95% of human colon cancers. The open reading frame encodes a 319-amino acid polypeptide having a putative secretory signal sequence and 3 potential glycosylation sites. The predicted mature protein has a 213-amino acid extracellular region, a single transmembrane domain, and a 62-amino acid intracellular tail. The sequence of the extracellular region contains 2 domains characteristic of the CD2 subgroup of the immunoglobulin (Ig) superfamily. [provided by RefSeq, Jul 2008]
• Protein Families: Druggable Genome, Transmembrane