CA8 (NM_004056) Human Mass Spec Standard
CAT#: PH310228
CA8 MS Standard C13 and N15-labeled recombinant protein (NP_004047)
Specifications
| Product Data | |
| Tag | C-Myc/DDK |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC210228 |
| Predicted MW | 33 kDa |
| Protein Sequence |
>RC210228 protein sequence
Red=Cloning site Green=Tags(s) MADLSFIEDTVAFPEKEEDEEEEEEGVEWGYEEGVEWGLVFPDANGEYQSPINLNSREARYDPSLLDVRL SPNYVVCRDCEVTNDGHTIQVILKSKSVLSGGPLPQGHEFELYEVRFHWGRENQRGSEHTVNFKAFPMEL HLIHWNSTLFGSIDEAVGKPHGIAIIALFVQIGKEHVGLKAVTEILQDIQYKGKSKTIPCFNPNTLLPDP LLRDYWVYEGSLTIPPCSEGVTWILFRYPLTISQLQIEEFRRLRTHVKGAELVEGCDGILGDNFRPTQPL SDRVIRAAFQ TRPLEQKLISEEDLAANDILDYKDDDDKV |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | 50 ug/ml as determined by BCA |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions. |
| Reference Data | |
| RefSeq | NP_004047 |
| RefSeq Size | 2278 |
| RefSeq ORF | 870 |
| Synonyms | CA-RP; CA-VIII; CALS; CAMRQ3; CARP |
| Locus ID | 767 |
| UniProt ID | P35219 |
| Cytogenetics | 8q12.1 |
| Summary | 'The protein encoded by this gene was initially named CA-related protein because of sequence similarity to other known carbonic anhydrase genes. However, the gene product lacks carbonic anhydrase activity (i.e., the reversible hydration of carbon dioxide). The gene product continues to carry a carbonic anhydrase designation based on clear sequence identity to other members of the carbonic anhydrase gene family. The absence of CA8 gene transcription in the cerebellum of the lurcher mutant in mice with a neurologic defect suggests an important role for this acatalytic form. Mutations in this gene are associated with cerebellar ataxia, mental retardation, and dysequilibrium syndrome 3 (CMARQ3). Polymorphisms in this gene are associated with osteoporosis, and overexpression of this gene in osteosarcoma cells suggests an oncogenic role. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Mar 2016]' |
| Protein Families | Druggable Genome |
| Protein Pathways | Nitrogen metabolism |
Documents
| FAQs |
Resources
Recombinant Protein Resources |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC418248 | CA8 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
| LY418248 | Transient overexpression lysate of carbonic anhydrase VIII (CA8) |
USD 436.00 |
|
| TP310228 | Recombinant protein of human carbonic anhydrase VIII (CA8) |
USD 823.00 |
|
| TP720093 | Purified recombinant protein of Homo sapiens carbonic anhydrase VIII (CA8) |
USD 330.00 |
{0} Product Review(s)
Be the first one to submit a review
Germany
Japan
United Kingdom
China