Macrophage Inflammatory Protein 4 (CCL18) (NM_002988) Human Mass Spec Standard

CAT#: PH310245

CCL18 MS Standard C13 and N15-labeled recombinant protein (NP_002979)

Product Images

Coomassie blue staining of purified CCL18 protein (Cat# TP310245). The protein was produced from HEK293T cells transfected with CCL18 cDNA clone (Cat# RC210245) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC210245
• Predicted MW: 9.8 kDa
• Protein Sequence:
  Sequence Link

  >RC210245 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MKGLAAALLVLVCTMALCSCAQVGTNKELCCLVYTSWQIPQKFIVDYSETSPQCPKPGVILLTKRGRQIC
  ADPNKKWVQKYISDLKLNA
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_002979
• RefSeq Size: 798
• RefSeq ORF: 267
• Synonyms: AMAC-1; AMAC1; CKb7; DC-CK1; DCCK1; MIP-4; PARC; SCYA18
• Locus ID: 6362
• UniProt ID: P55774
• Cytogenetics: 17q12
• Summary: 'This antimicrobial gene is one of several Cys-Cys (CC) cytokine genes clustered on the q arm of chromosome 17. Cytokines are a family of secreted proteins involved in immunoregulatory and inflammatory processes. The CC cytokines are proteins characterized by two adjacent cysteines. The cytokine encoded by this gene displays chemotactic activity for naive T cells, CD4+ and CD8+ T cells and nonactivated lymphocytes, but not for monocytes or granulocytes. This chemokine attracts naive T lymphocytes toward dendritic cells and activated macrophages in lymph nodes. It may play a role in both humoral and cell-mediated immunity responses. [provided by RefSeq, Sep 2014]'
• Protein Families: Druggable Genome, Secreted Protein
• Protein Pathways: Chemokine signaling pathway, Cytokine-cytokine receptor interaction