SOX18 (NM_018419) Human Mass Spec Standard

CAT#: PH310323

SOX18 MS Standard C13 and N15-labeled recombinant protein (NP_060889)

Product Images

Coomassie blue staining of purified SOX18 protein (Cat# TP310323). The protein was produced from HEK293T cells transfected with SOX18 cDNA clone (Cat# RC210323) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC210323
• Predicted MW: 40.7 kDa
• Protein Sequence:
  Sequence Link

  >RC210323 representing NM_018419
  Red=Cloning site Green=Tags(s)
  
  MQRSPPGYGAQDDPPARRDCAWAPGHGAAADTRGLAAGPAALAAPAAPASPPSPQRSPPRSPEPGRYGLS
  PAGRGERQAADESRIRRPMNAFMVWAKDERKRLAQQNPDLHNAVLSKMLGKAWKELNAAEKRPFVEEAER
  LRVQHLRDHPNYKYRPRRKKQARKARRLEPGLLLPGLAPPQPPPEPFPAASGSARAFRELPPLGAEFDGL
  GLPTPERSPLDGLEPGEAAFFPPPAAPEDCALRPFRAPYAPTELSRDPGGCYGAPLAEALRTAPPAAPLA
  GLYYGTLGTPGPYPGPLSPPPEAPPLESAEPLGPAADLWADVDLTEFDQYLNCSRTRPDAPGLPYHVALA
  KLGPRAMSCPEESSLISALSDASSAVYYSACISGSGP
  
  SGPTRTRRLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_060889
• RefSeq Size: 1718
• RefSeq ORF: 2910
• Synonyms: HLTRS; HLTS
• Locus ID: 54345
• UniProt ID: P35713
• Cytogenetics: 20q13.33
• Summary: This gene encodes a member of the SOX (SRY-related HMG-box) family of transcription factors involved in the regulation of embryonic development and in the determination of the cell fate. The encoded protein may act as a transcriptional regulator after forming a protein complex with other proteins. This protein plays a role in hair, blood vessel, and lymphatic vessel development. Mutations in this gene have been associated with recessive and dominant forms of hypotrichosis-lymphedema-telangiectasia. [provided by RefSeq, Jul 2008]
• Protein Families: Transcription Factors