p53R2 (RRM2B) (NM_015713) Human Mass Spec Standard

CAT#: PH310340

RRM2B MS Standard C13 and N15-labeled recombinant protein (NP_056528)

Product Images

Coomassie blue staining of purified RRM2B protein (Cat# TP310340). The protein was produced from HEK293T cells transfected with RRM2B cDNA clone (Cat# RC210340) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC210340
• Predicted MW: 40.7 kDa
• Protein Sequence:
  Sequence Link

  >RC210340 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MGDPERPEAAGLDQDERSSSDTNESEIKSNEEPLLRKSSRRFVIFPIQYPDIWKMYKQAQASFWTAEEVD
  LSKDLPHWNKLKADEKYFISHILAFFAASDGIVNENLVERFSQEVQVPEARCFYGFQILIENVHSEMYSL
  LIDTYIRDPKKREFLFNAIETMPYVKKKADWALRWIADRKSTFGERVVAFAAVEGVFFSGSFAAIFWLKK
  RGLMPGLTFSNELISRDEGLHCDFACLMFQYLVNKPSEERVREIIVDAVKIEQEFLTEALPVGLIGMNCI
  LMKQYIEFVADRLLVELGFSKVFQAENPFDFMENISLEGKTNFFEKRVSEYQRFAVMAETTDNVFTLDAD
  F
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_056528
• RefSeq Size: 4932
• RefSeq ORF: 1053
• Synonyms: MTDPS8A; MTDPS8B; P53R2
• Locus ID: 50484
• UniProt ID: Q7LG56
• Cytogenetics: 8q22.3
• Summary: This gene encodes the small subunit of a p53-inducible ribonucleotide reductase. This heterotetrameric enzyme catalyzes the conversion of ribonucleoside diphosphates to deoxyribonucleoside diphosphates. The product of this reaction is necessary for DNA synthesis. Mutations in this gene have been associated with autosomal recessive mitochondrial DNA depletion syndrome, autosomal dominant progressive external ophthalmoplegia-5, and mitochondrial neurogastrointestinal encephalopathy. Alternatively spliced transcript variants have been described. [provided by RefSeq, Feb 2010]
• Protein Families: Druggable Genome, Transmembrane
• Protein Pathways: Glutathione metabolism, Metabolic pathways, p53 signaling pathway, Purine metabolism, Pyrimidine metabolism