p53R2 (RRM2B) (NM_015713) Human Recombinant Protein
CAT#: TP310340
Recombinant protein of human ribonucleotide reductase M2 B (TP53 inducible) (RRM2B)
View other "RRM2B" proteins (5)
Special Offer: Get a 20% discount on this product. Use code: "MVPro20".
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC210340 protein sequence
Red=Cloning site Green=Tags(s) MGDPERPEAAGLDQDERSSSDTNESEIKSNEEPLLRKSSRRFVIFPIQYPDIWKMYKQAQASFWTAEEVD LSKDLPHWNKLKADEKYFISHILAFFAASDGIVNENLVERFSQEVQVPEARCFYGFQILIENVHSEMYSL LIDTYIRDPKKREFLFNAIETMPYVKKKADWALRWIADRKSTFGERVVAFAAVEGVFFSGSFAAIFWLKK RGLMPGLTFSNELISRDEGLHCDFACLMFQYLVNKPSEERVREIIVDAVKIEQEFLTEALPVGLIGMNCI LMKQYIEFVADRLLVELGFSKVFQAENPFDFMENISLEGKTNFFEKRVSEYQRFAVMAETTDNVFTLDAD F myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 40.6 kDa |
Concentration | >50 ug/mL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_056528 |
Locus ID | 50484 |
UniProt ID | Q7LG56 |
Cytogenetics | 8q22.3 |
Refseq Size | 4932 |
Refseq ORF | 1053 |
Synonyms | MTDPS8A; MTDPS8B; P53R2 |
Summary | This gene encodes the small subunit of a p53-inducible ribonucleotide reductase. This heterotetrameric enzyme catalyzes the conversion of ribonucleoside diphosphates to deoxyribonucleoside diphosphates. The product of this reaction is necessary for DNA synthesis. Mutations in this gene have been associated with autosomal recessive mitochondrial DNA depletion syndrome, autosomal dominant progressive external ophthalmoplegia-5, and mitochondrial neurogastrointestinal encephalopathy. Alternatively spliced transcript variants have been described.[provided by RefSeq, Feb 2010] |
Protein Families | Druggable Genome, Transmembrane |
Protein Pathways | Glutathione metabolism, Metabolic pathways, p53 signaling pathway, Purine metabolism, Pyrimidine metabolism |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC414401 | RRM2B HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LC433055 | RRM2B HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LY414401 | Transient overexpression lysate of ribonucleotide reductase M2 B (TP53 inducible) (RRM2B) |
USD 396.00 |
|
LY433055 | Transient overexpression lysate of ribonucleotide reductase M2 B (TP53 inducible) (RRM2B), transcript variant 2 |
USD 396.00 |
|
PH310340 | RRM2B MS Standard C13 and N15-labeled recombinant protein (NP_056528) |
USD 2,055.00 |
{0} Product Review(s)
Be the first one to submit a review