PD1 (PDCD1) (NM_005018) Human Mass Spec Standard
CAT#: PH310364
PD-1 / PDCD1 MS Standard C13 and N15-labeled recombinant protein (NP_005009)
Specifications
| Product Data | |
| Tag | C-Myc/DDK |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC210364 |
| Predicted MW | 31.6 kDa |
| Protein Sequence |
>RC210364 protein sequence
Red=Cloning site Green=Tags(s) MQIPQAPWPVVWAVLQLGWRPGWFLDSPDRPWNPPTFSPALLVVTEGDNATFTCSFSNTSESFVLNWYRM SPSNQTDKLAAFPEDRSQPGQDCRFRVTQLPNGRDFHMSVVRARRNDSGTYLCGAISLAPKAQIKESLRA ELRVTERRAEVPTAHPSPSPRPAGQFQTLVVGVVGGLLGSLVLLVWVLAVICSRAARGTIGARRTGQPLK EDPSAVPVFSVDYGELDFQWREKTPEPPVPCVPEQTEYATIVFPSGMGTSSPARRGSADGPRSAQPLRPE DGHCSWPL myc-FLAG tag |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | 50 ug/ml as determined by BCA |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions. |
| Reference Data | |
| RefSeq | NP_005009 |
| RefSeq Size | 2115 |
| RefSeq ORF | 864 |
| Synonyms | CD279; hPD-1; hPD-l; hSLE1; PD-1; PD1; SLEB2 |
| Locus ID | 5133 |
| UniProt ID | Q15116, A0A0M3M0G7 |
| Cytogenetics | 2q37.3 |
| Summary | 'Programmed cell death protein 1 (PDCD1) is an immune-inhibitory receptor expressed in activated T cells; it is involved in the regulation of T-cell functions, including those of effector CD8+ T cells. In addition, this protein can also promote the differentiation of CD4+ T cells into T regulatory cells. PDCD1 is expressed in many types of tumors including melanomas, and has demonstrated to play a role in anti-tumor immunity. Moreover, this protein has been shown to be involved in safeguarding against autoimmunity, however, it can also contribute to the inhibition of effective anti-tumor and anti-microbial immunity. [provided by RefSeq, Aug 2020]' |
| Protein Families | Druggable Genome, Transmembrane |
| Protein Pathways | Cell adhesion molecules (CAMs), T cell receptor signaling pathway |
Documents
| FAQs |
Resources
Recombinant Protein Resources |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC401555 | PDCD1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
| LY401555 | Transient overexpression lysate of programmed cell death 1 (PD-1 / PDCD1) |
USD 436.00 |
|
| TP310364 | Recombinant protein of human programmed cell death 1 (PDCD1) |
USD 823.00 |
|
| TP700198 | Purified recombinant protein of Homo sapiens programmed cell death 1 (PDCD1), 25-167aa, with C-terminal DDK/His tag, expressed in HEK293 cells. |
USD 748.00 |
|
| TP700199 | Purified recombinant protein of Homo sapiens programmed cell death 1 (PD1/PDCD1), residues 25-167aa, with C-terminal Fc tag, expressed in HEK293 cells. |
USD 748.00 |
{0} Product Review(s)
Be the first one to submit a review
Germany
Japan
United Kingdom
China