Protein kinase Y linked (PRKY) (NM_002760) Human Mass Spec Standard

CAT#: PH310438

PRKY MS Standard C13 and N15-labeled recombinant protein (NP_002751)

Product Images

Coomassie blue staining of purified PRKY protein (Cat# TP310438). The protein was produced from HEK293T cells transfected with PRKY cDNA clone (Cat# RC210438) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC210438
• Predicted MW: 31.7 kDa
• Protein Sequence:
  Sequence Link

  >RC210438 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MEAPGPAQAAAAESNSREVTEDAADWAPALCPSPEARSPEAPAYRLQDCDALVTMGTGTFGRVHLVKEKT
  AKHFFALKVMSIPDVIRRKQEQHVHNEKSVLKEVSHPFLIRLFWTWHEERFLYMLMEYVPGGELFSYLRN
  RGHFSSTTGLFYSAEIICAIEYLHSKEIVYRDLKPENILLDRDGHIKLTDFGFAKKLVDRTWTLCGTPEY
  LAPEVIQSKGHGRAVDWWALGILIFEMLSGFPPFFDDNPFGIYQKILAGKLYFPRHLDFHVKTGRMM
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_002751
• RefSeq Size: 7216
• RefSeq ORF: 831
• Synonyms: OTTHUMP00000033227; protein kinase, Y-linked
• Locus ID: 5616
• Cytogenetics: Yp11.2
• Summary: 'This gene is similar to the protein kinase, X-linked gene in the pseudoautosomal region of the X chromosome. The gene is classified as a transcribed pseudogene because it has lost a coding exon that results in all transcripts being candidates for nonsense-mediated decay (NMD) and unlikely to express a protein. Abnormal recombination between this gene and a related gene on chromosome X is a frequent cause of XX males and XY females. [provided by RefSeq, Jul 2010]'
• Protein Families: Druggable Genome, Protein Kinase