MRPL39 (NM_017446) Human Mass Spec Standard

CAT#: PH310449

MRPL39 MS Standard C13 and N15-labeled recombinant protein (NP_059142)

Product Images

Coomassie blue staining of purified MRPL39 protein (Cat# TP310449). The protein was produced from HEK293T cells transfected with MRPL39 cDNA clone (Cat# RC210449) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC210449
• Predicted MW: 38.7 kDa
• Protein Sequence:
  Sequence Link

  >RC210449 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MEALAMGSRALRLWLVAPGGGIKWRFIATSPASQLSPTELTEMRNDLFNKEKARQLSLTPRTEKIEVKHV
  GKTDPGTVFVMNKNISTPYSCAMHLSEWYCRKSILALVDGQPWDMYKPLTKSCEIKFLTFKDCDPGEVNK
  AYWRSCAMMMGCVIERAFKDEYMVNLVRAPEVPVISGAFCYDVVLDSKLDEWMPTKENLRSFTKDAHALI
  YKDLPFETLEVEAKVALEIFQHSKYKVDFIEEKASQNPERIVKLHRIGDFIDVSEGPLIPRTSICFQYEV
  SAVHNLQPTQPSLIRRFQGVSLPVHLRAHFTIWDKLLERSRKMVTEDQSKATEECTST
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_059142
• RefSeq Size: 1082
• RefSeq ORF: 1014
• Synonyms: C21orf92; L39mt; MRP-L5; MRPL5; MSTP003; PRED22; PRED66; RPML5
• Locus ID: 54148
• UniProt ID: Q9NYK5
• Cytogenetics: 21q21.3
• Summary: Mammalian mitochondrial ribosomal proteins are encoded by nuclear genes and help in protein synthesis within the mitochondrion. Mitochondrial ribosomes (mitoribosomes) consist of a small 28S subunit and a large 39S subunit. They have an estimated 75% protein to rRNA composition compared to prokaryotic ribosomes, where this ratio is reversed. Another difference between mammalian mitoribosomes and prokaryotic ribosomes is that the latter contain a 5S rRNA. Among different species, the proteins comprising the mitoribosome differ greatly in sequence, and sometimes in biochemical properties, which prevents easy recognition by sequence homology. This gene encodes a 39S subunit protein. Two transcript variants encoding distinct isoforms have been described. A pseudogene corresponding to this gene is found on chromosome 5q. [provided by RefSeq, Jul 2008]