SPTSSB (NM_001040100) Human Mass Spec Standard

CAT#: PH310453

C3orf57 MS Standard C13 and N15-labeled recombinant protein (NP_001035189)

Product Images

Coomassie blue staining of purified SPTSSB protein (Cat# TP310453). The protein was produced from HEK293T cells transfected with SPTSSB cDNA clone (Cat# RC210453) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC210453
• Predicted MW: 9.2 kDa
• Protein Sequence:
  Sequence Link

  >RC210453 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MDLRRVKEYFSWLYYQYQIISCCAVLEPWERSMFNTILLTIIAMVVYTAYVFIPIHIRLAWEFFSKICGY
  HSTISN
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_001035189
• RefSeq Size: 2306
• RefSeq ORF: 228
• Synonyms: ADMP; C3orf57; SSSPTB
• Locus ID: 165679
• UniProt ID: Q8NFR3, Q6ZWB5
• Cytogenetics: 3q26.1
• Summary: Serine palmitoyltransferase (SPT; EC 2.3.1.50) catalyzes the first committed and rate-limiting step in sphingolipid biosynthesis. SSSPTB is a small SPT subunit that stimulates SPT activity and confers acyl-CoA preference to the SPT catalytic heterodimer of SPTLC1 (MIM 605712) and either SPTLC2 (MIM 605713) or SPTLC3 (MIM 611120) (Han et al., 2009 [PubMed 19416851]). [supplied by OMIM, Nov 2010]
• Protein Families: Transmembrane