SPTSSB (NM_001040100) Human Recombinant Protein

CAT#: TP310453

Recombinant protein of human chromosome 3 open reading frame 57 (C3orf57)

Product Images

Coomassie blue staining of purified SPTSSB protein (Cat# TP310453). The protein was produced from HEK293T cells transfected with SPTSSB cDNA clone (Cat# RC210453) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC210453 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MDLRRVKEYFSWLYYQYQIISCCAVLEPWERSMFNTILLTIIAMVVYTAYVFIPIHIRLAWEFFSKICGY
  HSTISN
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 9 kDa
• Concentration: >50 ug/mL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_001035189
• Locus ID: 165679
• UniProt ID: Q8NFR3, Q6ZWB5
• Cytogenetics: 3q26.1
• Refseq Size: 2306
• Refseq ORF: 228
• Synonyms: ADMP; C3orf57; SSSPTB
• Summary: Serine palmitoyltransferase (SPT; EC 2.3.1.50) catalyzes the first committed and rate-limiting step in sphingolipid biosynthesis. SSSPTB is a small SPT subunit that stimulates SPT activity and confers acyl-CoA preference to the SPT catalytic heterodimer of SPTLC1 (MIM 605712) and either SPTLC2 (MIM 605713) or SPTLC3 (MIM 611120) (Han et al., 2009 [PubMed 19416851]).[supplied by OMIM, Nov 2010]
• Protein Families: Transmembrane