HMG14 (HMGN1) (NM_004965) Human Mass Spec Standard

CAT#: PH310454

HMGN1 MS Standard C13 and N15-labeled recombinant protein (NP_004956)

Product Images

Coomassie blue staining of purified HMGN1 protein (Cat# TP310454). The protein was produced from HEK293T cells transfected with HMGN1 cDNA clone (Cat# RC210454) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC210454
• Predicted MW: 10.7 kDa
• Protein Sequence:
  Sequence Link

  >RC210454 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MPKRKVSSTEGAAKEEPKRRSARLSAKPPAKVEANPKKAAAKDKSSDKKVQTKGKRGAKGKQAEVANQET
  KEDLPAENGETKTEESPASDEAGEKEAKSD
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_004956
• RefSeq Size: 1313
• RefSeq ORF: 300
• Synonyms: HMG14
• Locus ID: 3150
• UniProt ID: P05114, Q6NSG7
• Cytogenetics: 21q22.2
• Summary: 'The protein encoded by this gene binds nucleosomal DNA and is associated with transcriptionally active chromatin. Along with a similar protein, HMG17, the encoded protein may help maintain an open chromatin configuration around transcribable genes. [provided by RefSeq, Aug 2011]'
• Protein Families: Transcription Factors