COX6A1 (NM_004373) Human Mass Spec Standard

CAT#: PH310485

COX6A1 MS Standard C13 and N15-labeled recombinant protein (NP_004364)

Product Images

Coomassie blue staining of purified COX6A1 protein (Cat# TP310485). The protein was produced from HEK293T cells transfected with COX6A1 cDNA clone (Cat# RC210485) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC210485
• Predicted MW: 12.2 kDa
• Protein Sequence:
  Sequence Link

  >RC210485 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MAVVGVSSVSRLLGRSRPQLGRPMSSGAHGEEGSARMWKTLTFFVALPGVAVSMLNVYLKSHHGEHERPE
  FIAYPHLRIRTKPFPWGDGNHTLFHNPHVNPLPTGYEDE
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_004364
• RefSeq Size: 593
• RefSeq ORF: 327
• Synonyms: CMTRID; COX6A; COX6AL
• Locus ID: 1337
• UniProt ID: P12074, H6SG15
• Cytogenetics: 12q24.2
• Summary: 'Cytochrome c oxidase (COX), the terminal enzyme of the mitochondrial respiratory chain, catalyzes the electron transfer from reduced cytochrome c to oxygen. It is a heteromeric complex consisting of 3 catalytic subunits encoded by mitochondrial genes and multiple structural subunits encoded by nuclear genes. The mitochondrially-encoded subunits function in the electron transfer and the nuclear-encoded subunits may function in the regulation and assembly of the complex. This nuclear gene encodes polypeptide 1 (liver isoform) of subunit VIa, and polypeptide 1 is found in all non-muscle tissues. Polypeptide 2 (heart/muscle isoform) of subunit VIa is encoded by a different gene, and is present only in striated muscles. These two polypeptides share 66% amino acid sequence identity. It has been reported that there may be several pseudogenes on chromosomes 1, 6, 7q21, 7q31-32 and 12. However, only one pseudogene (COX6A1P) on chromosome 1p31.1 has been documented. [provided by RefSeq, Jul 2008]'
• Protein Families: Transmembrane
• Protein Pathways: Alzheimer's disease, Cardiac muscle contraction, Huntington's disease, Metabolic pathways, Oxidative phosphorylation, Parkinson's disease