RAB21 (NM_014999) Human Mass Spec Standard

CAT#: PH310510

RAB21 MS Standard C13 and N15-labeled recombinant protein (NP_055814)

Product Images

Coomassie blue staining of purified RAB21 protein (Cat# TP310510). The protein was produced from HEK293T cells transfected with RAB21 cDNA clone (Cat# RC210510) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC210510
• Predicted MW: 24.3 kDa
• Protein Sequence:
  Sequence Link

  >RC210510 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MAAAGGGGGGAAAAGRAYSFKVVLLGEGCVGKTSLVLRYCENKFNDKHITTLQASFLTKKLNIGGKRVNL
  AIWDTAGQERFHALGPIYYRDSNGAILVYDITDEDSFQKVKNWVKELRKMLGNEICLCIVGNKIDLEKER
  HVSIQEAESYAESVGAKHYHTSAKQNKGIEELFLDLCKRMIETAQVDERAKGNGSSQPGTARRGVQIIDD
  EPQAQTSGGGCCSSG
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_055814
• RefSeq Size: 2627
• RefSeq ORF: 675
• Synonyms: KIAA0118
• Locus ID: 23011
• UniProt ID: Q9UL25, A0A024RBA9
• Cytogenetics: 12q21.1
• Summary: This gene belongs to the Rab family of monomeric GTPases, which are involved in the control of cellular membrane traffic. The encoded protein plays a role in the targeted trafficking of integrins via its association with integrin alpha tails. As a consequence, the encoded protein is involved in the regulation of cell adhesion and migration. Expression of this gene is associated with a poor prognosis for glioma patients. This gene is downregulated by the tumor suppressor miR-200b, and miRNA-200b is itself downregulated in glioma tissues. [provided by RefSeq, Nov 2015]
• Protein Families: Druggable Genome