ATG5 (NM_004849) Human Mass Spec Standard
CAT#: PH310563
ATG5 MS Standard C13 and N15-labeled recombinant protein (NP_004840)
Specifications
| Product Data | |
| Tag | C-Myc/DDK |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC210563 |
| Predicted MW | 32.4 kDa |
| Protein Sequence |
>RC210563 protein sequence
Red=Cloning site Green=Tags(s) MTDDKDVLRDVWFGRIPTCFTLYQDEITEREAEPYYLLLPRVSYLTLVTDKVKKHFQKVMRQEDISEIWF EYEGTPLKWHYPIGLLFDLLASSSALPWNITVHFKSFPEKDLLHCPSKDAIEAHFMSCMKEADALKHKSQ VINEMQKKDHKQLWMGLQNDRFDQFWAINRKLMEYPAEENGFRYIPFRIYQTTTERPFIQKLFRPVAADG QLHTLGDLLKEVCPSAIDPEDGEKKNQVMIHGIEPMLETPLQWLSEHLSYPDNFLHISIIPQPTD myc-FLAG tag |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | 50 ug/ml as determined by BCA |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions. |
| Reference Data | |
| RefSeq | NP_004840 |
| RefSeq Size | 3260 |
| RefSeq ORF | 825 |
| Synonyms | APG5; APG5-LIKE; APG5L; ASP; hAPG5; SCAR25 |
| Locus ID | 9474 |
| UniProt ID | Q9H1Y0, Q7Z3H3, A9UGY9 |
| Cytogenetics | 6q21 |
| Summary | The protein encoded by this gene, in combination with autophagy protein 12, functions as an E1-like activating enzyme in a ubiquitin-like conjugating system. The encoded protein is involved in several cellular processes, including autophagic vesicle formation, mitochondrial quality control after oxidative damage, negative regulation of the innate antiviral immune response, lymphocyte development and proliferation, MHC II antigen presentation, adipocyte differentiation, and apoptosis. Several transcript variants encoding different protein isoforms have been found for this gene. [provided by RefSeq, Sep 2015] |
| Protein Families | Druggable Genome |
| Protein Pathways | Regulation of autophagy, RIG-I-like receptor signaling pathway |
Documents
| FAQs |
Resources
Recombinant Protein Resources |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC401532 | ATG5 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
| LY401532 | Transient overexpression lysate of ATG5 autophagy related 5 homolog (S. cerevisiae) (ATG5) |
USD 436.00 |
|
| TP310563 | Recombinant protein of human ATG5 autophagy related 5 homolog (S. cerevisiae) (ATG5) |
USD 823.00 |
|
| TP720995 | Purified recombinant protein of Human ATG5 autophagy related 5 homolog (S. cerevisiae) (ATG5) |
USD 330.00 |
{0} Product Review(s)
Be the first one to submit a review
Germany
Japan
United Kingdom
China