Ephrin A1 (EFNA1) (NM_004428) Human Mass Spec Standard
CAT#: PH310635
EFNA1 MS Standard C13 and N15-labeled recombinant protein (NP_004419)
Specifications
| Product Data | |
| Tag | C-Myc/DDK |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC210635 |
| Predicted MW | 23.8 kDa |
| Protein Sequence |
>RC210635 protein sequence
Red=Cloning site Green=Tags(s) MEFLWAPLLGLCCSLAAADRHTVFWNSSNPKFRNEDYTIHVQLNDYVDIICPHYEDHSVADAAMEQYILY LVEHEEYQLCQPQSKDQVRWQCNRPSAKHGPEKLSEKFQRFTPFTLGKEFKEGHSYYYISKPIHQHEDRC LRLKVTVSGKITHSPQAHDNPQEKRLAADDPEVRVLHSIGHSAAPRLFPLAWTVLLLPLLLLQTP myc-FLAG tag |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | 50 ug/ml as determined by BCA |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions. |
| Reference Data | |
| RefSeq | NP_004419 |
| RefSeq Size | 1590 |
| RefSeq ORF | 615 |
| Synonyms | B61; ECKLG; EFL1; EPLG1; LERK-1; LERK1; TNFAIP4 |
| Locus ID | 1942 |
| UniProt ID | P20827 |
| Cytogenetics | 1q22 |
| Summary | 'This gene encodes a member of the ephrin (EPH) family. The ephrins and EPH-related receptors comprise the largest subfamily of receptor protein-tyrosine kinases and have been implicated in mediating developmental events, especially in the nervous system and in erythropoiesis. Based on their structures and sequence relationships, ephrins are divided into the ephrin-A (EFNA) class, which are anchored to the membrane by a glycosylphosphatidylinositol linkage, and the ephrin-B (EFNB) class, which are transmembrane proteins. This gene encodes an EFNA class ephrin which binds to the EPHA2, EPHA4, EPHA5, EPHA6, and EPHA7 receptors. Two transcript variants that encode different isoforms were identified through sequence analysis. [provided by RefSeq, Jul 2008]' |
| Protein Families | Druggable Genome |
| Protein Pathways | Axon guidance |
Documents
| FAQs |
Resources
Recombinant Protein Resources |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC401408 | EFNA1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
| LC405448 | EFNA1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
| LY401408 | Transient overexpression lysate of ephrin-A1 (EFNA1), transcript variant 1 |
USD 436.00 |
|
| LY405448 | Transient overexpression lysate of ephrin-A1 (EFNA1), transcript variant 2 |
USD 436.00 |
|
| TP310635 | Recombinant protein of human ephrin-A1 (EFNA1), transcript variant 1 |
USD 439.00 |
|
| TP720763 | Purified recombinant protein of Human ephrin-A1 (EFNA1), transcript variant 1 |
USD 330.00 |
|
| TP760225 | Recombinant protein of human ephrin-A1 (EFNA1), transcript variant 2, full length, with N-terminal HIS tag, expressed in E.Coli, 50ug |
USD 215.00 |
{0} Product Review(s)
Be the first one to submit a review
Germany
Japan
United Kingdom
China