GFUS (NM_003313) Human Mass Spec Standard

CAT#: PH310643

TSTA3 MS Standard C13 and N15-labeled recombinant protein (NP_003304)

Product Images

Coomassie blue staining of purified TSTA3 protein (Cat# TP310643). The protein was produced from HEK293T cells transfected with TSTA3 cDNA clone (Cat# RC210643) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC210643
• Predicted MW: 35.9 kDa
• Protein Sequence:
  Sequence Link

  >RC210643 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MGEPQGSMRILVTGGSGLVGKAIQKVVADGAGLPGEDWVFVSSKDADLTDTAQTRALFEKVQPTHVIHLA
  AMVGGLFRNIKYNLDFWRKNVHMNDNVLHSAFEVGARKVVSCLSTCIFPDKTTYPIDETMIHNGPPHNSN
  FGYSYAKRMIDVQNRAYFQQYGCTFTAVIPTNVFGPHDNFNIEDGHVLPGLIHKVHLAKSSGSALTVWGT
  GNPRRQFIYSLDLAQLFIWVLREYNEVEPIILSVGEEDEVSIKEAAEAVVEAMDFHGEVTFDTTKSDGQF
  KKTASNSKLRTYLPDFRFTPFKQAVKETCAWFTDNYEQARK
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_003304
• RefSeq Size: 1363
• RefSeq ORF: 963
• Synonyms: FX; P35B; SDR4E1
• Locus ID: 7264
• UniProt ID: Q13630, A0A140VKC8
• Cytogenetics: 8q24.3
• Summary: 'Tissue specific transplantation antigen P35B is a NADP(H)-binding protein. It catalyze the two-step epimerase and the reductase reactions in GDP-D-mannose metabolism, converting GDP-4-keto-6-D-deoxymannose to GDP-L-fucose. GDP-L-fucose is the substrate of several fucosyltransferases involved in the expression of many glycoconjugates, including blood group ABH antigens and developmental adhesion antigens. Mutations in this gene may cause leukocyte adhesion deficiency, type II. [provided by RefSeq, Jul 2008]'
• Protein Families: Druggable Genome
• Protein Pathways: Amino sugar and nucleotide sugar metabolism, Fructose and mannose metabolism, Metabolic pathways