GFUS (NM_003313) Human Mass Spec Standard
CAT#: PH310643
TSTA3 MS Standard C13 and N15-labeled recombinant protein (NP_003304)
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC210643 |
Predicted MW | 35.9 kDa |
Protein Sequence |
>RC210643 protein sequence
Red=Cloning site Green=Tags(s) MGEPQGSMRILVTGGSGLVGKAIQKVVADGAGLPGEDWVFVSSKDADLTDTAQTRALFEKVQPTHVIHLA AMVGGLFRNIKYNLDFWRKNVHMNDNVLHSAFEVGARKVVSCLSTCIFPDKTTYPIDETMIHNGPPHNSN FGYSYAKRMIDVQNRAYFQQYGCTFTAVIPTNVFGPHDNFNIEDGHVLPGLIHKVHLAKSSGSALTVWGT GNPRRQFIYSLDLAQLFIWVLREYNEVEPIILSVGEEDEVSIKEAAEAVVEAMDFHGEVTFDTTKSDGQF KKTASNSKLRTYLPDFRFTPFKQAVKETCAWFTDNYEQARK myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | 50 ug/ml as determined by BCA |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_003304 |
RefSeq Size | 1363 |
RefSeq ORF | 963 |
Synonyms | FX; P35B; SDR4E1 |
Locus ID | 7264 |
UniProt ID | Q13630, A0A140VKC8 |
Cytogenetics | 8q24.3 |
Summary | 'Tissue specific transplantation antigen P35B is a NADP(H)-binding protein. It catalyze the two-step epimerase and the reductase reactions in GDP-D-mannose metabolism, converting GDP-4-keto-6-D-deoxymannose to GDP-L-fucose. GDP-L-fucose is the substrate of several fucosyltransferases involved in the expression of many glycoconjugates, including blood group ABH antigens and developmental adhesion antigens. Mutations in this gene may cause leukocyte adhesion deficiency, type II. [provided by RefSeq, Jul 2008]' |
Protein Families | Druggable Genome |
Protein Pathways | Amino sugar and nucleotide sugar metabolism, Fructose and mannose metabolism, Metabolic pathways |
Documents
FAQs |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC418775 | TSTA3 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LY418775 | Transient overexpression lysate of tissue specific transplantation antigen P35B (TSTA3) |
USD 396.00 |
|
TP310643 | Recombinant protein of human tissue specific transplantation antigen P35B (TSTA3) |
USD 823.00 |
|
TP720506 | Recombinant protein of human tissue specific transplantation antigen P35B (TSTA3) |
USD 330.00 |
{0} Product Review(s)
Be the first one to submit a review