CUTA (NM_001014837) Human Mass Spec Standard
CAT#: PH310646
CUTA MS Standard C13 and N15-labeled recombinant protein (NP_001014837)
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC210646 |
Predicted MW | 16.8 kDa |
Protein Sequence |
>RC210646 protein sequence
Red=Cloning site Green=Tags(s) MPALLPVASRLLLLPRVLLTMASGSPPTQPSPASDSGSGYVPGSVSAAFVTCPNEKVAKEIARAVVEKRL AACVNLIPQITSIYEWKGKIEEDSEVLMMIKTQSSLVPALTDFVRSVHPYEVAEVIALPVEQGNFPYLQW VRQVTESVSDSITVLP myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | 50 ug/ml as determined by BCA |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_001014837 |
RefSeq Size | 1072 |
RefSeq ORF | 468 |
Synonyms | ACHAP; C6orf82 |
Locus ID | 51596 |
UniProt ID | O60888 |
Cytogenetics | 6p21.32 |
Summary | May form part of a complex of membrane proteins attached to acetylcholinesterase (AChE). [UniProtKB/Swiss-Prot Function] |
Protein Families | Transmembrane |
Documents
FAQs |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC414324 | CUTA HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LC423090 | CUTA HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LC423091 | CUTA HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LC425372 | CUTA HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LY414324 | Transient overexpression lysate of cutA divalent cation tolerance homolog (E. coli) (CUTA), transcript variant 2 |
USD 396.00 |
|
LY423090 | Transient overexpression lysate of cutA divalent cation tolerance homolog (E. coli) (CUTA), transcript variant 3 |
USD 396.00 |
|
LY423091 | Transient overexpression lysate of cutA divalent cation tolerance homolog (E. coli) (CUTA), transcript variant 4 |
USD 396.00 |
|
LY425372 | Transient overexpression lysate of cutA divalent cation tolerance homolog (E. coli) (CUTA), transcript variant 4 |
USD 396.00 |
|
PH300075 | CUTA MS Standard C13 and N15-labeled recombinant protein (NP_001014838) |
USD 2,055.00 |
|
PH319077 | CUTA MS Standard C13 and N15-labeled recombinant protein (NP_057005) |
USD 2,055.00 |
|
TP300075 | Recombinant protein of human cutA divalent cation tolerance homolog (E. coli) (CUTA), transcript variant 4 |
USD 823.00 |
|
TP310646 | Recombinant protein of human cutA divalent cation tolerance homolog (E. coli) (CUTA), transcript variant 3 |
USD 823.00 |
|
TP319077 | Recombinant protein of human cutA divalent cation tolerance homolog (E. coli) (CUTA), transcript variant 2 |
USD 748.00 |
|
TP720228 | Recombinant protein of human cutA divalent cation tolerance homolog (E. coli) (CUTA), transcript variant 1 |
USD 330.00 |
{0} Product Review(s)
Be the first one to submit a review