H2A.Z (H2AFZ) (NM_002106) Human Mass Spec Standard

CAT#: PH310691

H2AFZ MS Standard C13 and N15-labeled recombinant protein (NP_002097)

Product Images

Coomassie blue staining of purified H2AFZ protein (Cat# TP310691). The protein was produced from HEK293T cells transfected with H2AFZ cDNA clone (Cat# RC210691) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC210691
• Predicted MW: 13.6 kDa
• Protein Sequence:
  Sequence Link

  >RC210691 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MAGGKAGKDSGKAKTKAVSRSQRAGLQFPVGRIHRHLKSRTTSHGRVGATAAVYSAAILEYLTAEVLELA
  GNASKDLKVKRITPRHLQLAIRGDEELDSLIKATIAGGGVIPHIHKSLIGKKGQQKTV
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_002097
• RefSeq Size: 951
• RefSeq ORF: 384
• Synonyms: H2A.z; H2A.Z-1; H2A/z; H2AZ
• Locus ID: 3015
• UniProt ID: P0C0S5
• Cytogenetics: 4q23
• Summary: 'Histones are basic nuclear proteins that are responsible for the nucleosome structure of the chromosomal fiber in eukaryotes. Nucleosomes consist of approximately 146 bp of DNA wrapped around a histone octamer composed of pairs of each of the four core histones (H2A, H2B, H3, and H4). The chromatin fiber is further compacted through the interaction of a linker histone, H1, with the DNA between the nucleosomes to form higher order chromatin structures. This gene encodes a replication-independent member of the histone H2A family that is distinct from other members of the family. Studies in mice have shown that this particular histone is required for embryonic development and indicate that lack of functional histone H2A leads to embryonic lethality. [provided by RefSeq, Jul 2008]'
• Protein Families: Druggable Genome
• Protein Pathways: Systemic lupus erythematosus