Cystatin C (CST3) (NM_000099) Human Mass Spec Standard
CAT#: PH310730
CST3 MS Standard C13 and N15-labeled recombinant protein (NP_000090)
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC210730 |
Predicted MW | 15.8 kDa |
Protein Sequence |
>RC210730 protein sequence
Red=Cloning site Green=Tags(s) MAGPLRAPLLLLAILAVALAVSPAAGSSPGKPPRLVGGPMDASVEEEGVRRALDFAVGEYNKASNDMYHS RALQVVRARKQIVAGVNYFLDVELGRTTCTKTQPNLDNCPFHDQPHLKRKAFCSFQIYAVPWQGTMTLSK STCQDA myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | 50 ug/ml as determined by BCA |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_000090 |
RefSeq Size | 929 |
RefSeq ORF | 438 |
Synonyms | ARMD11; HEL-S-2 |
Locus ID | 1471 |
UniProt ID | P01034, A0A0K0K1J1 |
Cytogenetics | 20p11.21 |
Summary | 'The cystatin superfamily encompasses proteins that contain multiple cystatin-like sequences. Some of the members are active cysteine protease inhibitors, while others have lost or perhaps never acquired this inhibitory activity. There are three inhibitory families in the superfamily, including the type 1 cystatins (stefins), type 2 cystatins and the kininogens. The type 2 cystatin proteins are a class of cysteine proteinase inhibitors found in a variety of human fluids and secretions, where they appear to provide protective functions. The cystatin locus on chromosome 20 contains the majority of the type 2 cystatin genes and pseudogenes. This gene is located in the cystatin locus and encodes the most abundant extracellular inhibitor of cysteine proteases, which is found in high concentrations in biological fluids and is expressed in virtually all organs of the body. A mutation in this gene has been associated with amyloid angiopathy. Expression of this protein in vascular wall smooth muscle cells is severely reduced in both atherosclerotic and aneurysmal aortic lesions, establishing its role in vascular disease. In addition, this protein has been shown to have an antimicrobial function, inhibiting the replication of herpes simplex virus. Alternative splicing results in multiple transcript variants encoding a single protein. [provided by RefSeq, Nov 2014]' |
Protein Families | Druggable Genome, ES Cell Differentiation/IPS, Transmembrane |
Documents
FAQs |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC400040 | CST3 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 99.00 |
|
LY400040 | Transient overexpression lysate of cystatin C (CST3) |
USD 325.00 |
|
TP310730 | Recombinant protein of human cystatin C (CST3) |
USD 439.00 |
|
TP721134 | Purified recombinant protein of Human cystatin C (CST3) |
USD 300.00 |
|
TP721238 | Purified recombinant protein of Human cystatin C (CST3) |
USD 330.00 |
{0} Product Review(s)
Be the first one to submit a review