TOMM20 (NM_014765) Human Mass Spec Standard

CAT#: PH310746

TOMM20 MS Standard C13 and N15-labeled recombinant protein (NP_055580)

Product Images

Coomassie blue staining of purified TOMM20 protein (Cat# TP310746). The protein was produced from HEK293T cells transfected with TOMM20 cDNA clone (Cat# RC210746) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC210746
• Predicted MW: 16.3 kDa
• Protein Sequence:
  Sequence Link

  >RC210746 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MVGRNSAIAAGVCGALFIGYCIYFDRKRRSDPNFKNRLRERRKKQKLAKERAGLSKLPDLKDAEAVQKFF
  LEEIQLGEELLAQGEYEKGVDHLTNAIAVCGQPQQLLQVLQQTLPPPVFQMLLTKLPTISQRIVSAQSLA
  EDDVE
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_055580
• RefSeq Size: 3407
• RefSeq ORF: 435
• Synonyms: MAS20; MOM19; TOM20
• Locus ID: 9804
• UniProt ID: Q15388, A0A024R3W2
• Cytogenetics: 1q42.3
• Protein Families: Druggable Genome, Transmembrane