galectin 9 (LGALS9) (NM_002308) Human Mass Spec Standard
CAT#: PH310750
LGALS9 MS Standard C13 and N15-labeled recombinant protein (NP_002299)
Specifications
| Product Data | |
| Tag | C-Myc/DDK |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC210750 |
| Predicted MW | 35.9 kDa |
| Protein Sequence |
>RC210750 protein sequence
Red=Cloning site Green=Tags(s) MAFSGSQAPYLSPAVPFSGTIQGGLQDGLQITVNGTVLSSSGTRFAVNFQTGFSGNDIAFHFNPRFEDGG YVVCNTRQNGSWGPEERKTHMPFQKGMPFDLCFLVQSSDFKVMVNGILFVQYFHRVPFHRVDTISVNGSV QLSYISFQPPGVWPANPAPITQTVIHTVQSAPGQMFSTPAIPPMMYPHPAYPMPFITTILGGLYPSKSIL LSGTVLPSAQRFHINLCSGNHIAFHLNPRFDENAVVRNTQIDNSWGSEERSLPRKMPFVRGQSFSVWILC EAHCLKVAVDGQHLFEYYHRLRNLPTINRLEVGGDIQLTHVQT myc-FLAG tag |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | 50 ug/ml as determined by BCA |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions. |
| Reference Data | |
| RefSeq | NP_002299 |
| RefSeq Size | 1739 |
| RefSeq ORF | 969 |
| Synonyms | HUAT; LGALS9A |
| Locus ID | 3965 |
| UniProt ID | O00182, A0A024QZ02 |
| Cytogenetics | 17q11.2 |
| Summary | 'The galectins are a family of beta-galactoside-binding proteins implicated in modulating cell-cell and cell-matrix interactions. The protein encoded by this gene is an S-type lectin. It is overexpressed in Hodgkin's disease tissue and might participate in the interaction between the H&RS cells with their surrounding cells and might thus play a role in the pathogenesis of this disease and/or its associated immunodeficiency. Multiple alternatively spliced transcript variants have been found for this gene. [provided by RefSeq, Jul 2008]' |
Documents
| FAQs |
Resources
Recombinant Protein Resources |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC419406 | LGALS9 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
| LY419406 | Transient overexpression lysate of lectin, galactoside-binding, soluble, 9 (LGALS9), transcript variant 2 |
USD 436.00 |
|
| PH319435 | LGALS9 MS Standard C13 and N15-labeled recombinant protein (NP_033665) |
USD 2,055.00 |
|
| TP310750 | Recombinant protein of human lectin, galactoside-binding, soluble, 9 (LGALS9), transcript variant 2 |
USD 823.00 |
|
| TP319435 | Purified recombinant protein of Homo sapiens lectin, galactoside-binding, soluble, 9 (LGALS9), transcript variant 1, 20 µg |
USD 867.00 |
{0} Product Review(s)
Be the first one to submit a review
Germany
Japan
United Kingdom
China