Tartrate Resistant Acid Phosphatase (ACP5) (NM_001611) Human Mass Spec Standard

CAT#: PH310752

ACP5 MS Standard C13 and N15-labeled recombinant protein (NP_001602)

Product Images

Coomassie blue staining of purified ACP5 protein (Cat# TP310752). The protein was produced from HEK293T cells transfected with ACP5 cDNA clone (Cat# RC210752) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC210752
• Predicted MW: 36.6 kDa
• Protein Sequence:
  Sequence Link

  >RC210752 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MDMWTALLILQALLLPSLADGATPALRFVAVGDWGGVPNAPFHTAREMANAKEIARTVQILGADFILSLG
  DNFYFTGVQDINDKRFQETFEDVFSDRSLRKVPWYVLAGNHDHLGNVSAQIAYSKISKRWNFPSPFYRLH
  FKIPQTNVSVAIFMLDTVTLCGNSDDFLSQQPERPRDVKLARTQLSWLKKQLAAAREDYVLVAGHYPVWS
  IAEHGPTHCLVKQLRPLLATYGVTAYLCGHDHNLQYLQDENGVGYVLSGAGNFMDPSKRHQRKVPNGYLR
  FHYGTEDSLGGFAYVEISSKEMTVTYIEASGKSLFKTRLPRRARP
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_001602
• RefSeq Size: 1506
• RefSeq ORF: 975
• Synonyms: HPAP; TRACP5a; TRACP5b; TRAP; TrATPase
• Locus ID: 54
• UniProt ID: P13686, A0A024R7F8
• Cytogenetics: 19p13.2
• Summary: 'This gene encodes an iron containing glycoprotein which catalyzes the conversion of orthophosphoric monoester to alcohol and orthophosphate. It is the most basic of the acid phosphatases and is the only form not inhibited by L(+)-tartrate. [provided by RefSeq, Aug 2008]'
• Protein Families: Druggable Genome
• Protein Pathways: Lysosome, Riboflavin metabolism