Tartrate Resistant Acid Phosphatase (ACP5) (NM_001611) Human Recombinant Protein
CAT#: TP310752
Recombinant protein of human acid phosphatase 5, tartrate resistant (ACP5), transcript variant 4
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC210752 protein sequence
Red=Cloning site Green=Tags(s) MDMWTALLILQALLLPSLADGATPALRFVAVGDWGGVPNAPFHTAREMANAKEIARTVQILGADFILSLG DNFYFTGVQDINDKRFQETFEDVFSDRSLRKVPWYVLAGNHDHLGNVSAQIAYSKISKRWNFPSPFYRLH FKIPQTNVSVAIFMLDTVTLCGNSDDFLSQQPERPRDVKLARTQLSWLKKQLAAAREDYVLVAGHYPVWS IAEHGPTHCLVKQLRPLLATYGVTAYLCGHDHNLQYLQDENGVGYVLSGAGNFMDPSKRHQRKVPNGYLR FHYGTEDSLGGFAYVEISSKEMTVTYIEASGKSLFKTRLPRRARP myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 34.3 kDa |
Concentration | >50 ug/mL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_001602 |
Locus ID | 54 |
UniProt ID | P13686, A0A024R7F8 |
Cytogenetics | 19p13.2 |
Refseq Size | 1506 |
Refseq ORF | 975 |
Synonyms | HPAP; TRACP5a; TRACP5b; TRAP; TrATPase |
Summary | This gene encodes an iron containing glycoprotein which catalyzes the conversion of orthophosphoric monoester to alcohol and orthophosphate. It is the most basic of the acid phosphatases and is the only form not inhibited by L(+)-tartrate. [provided by RefSeq, Aug 2008] |
Protein Families | Druggable Genome |
Protein Pathways | Lysosome, Riboflavin metabolism |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC400607 | ACP5 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 99.00 |
|
LC426340 | ACP5 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 99.00 |
|
LC426341 | ACP5 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 99.00 |
|
LC426342 | ACP5 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 99.00 |
|
LY400607 | Transient overexpression lysate of acid phosphatase 5, tartrate resistant (ACP5), transcript variant 4 |
USD 325.00 |
|
LY426340 | Transient overexpression lysate of acid phosphatase 5, tartrate resistant (ACP5), transcript variant 2 |
USD 325.00 |
|
LY426341 | Transient overexpression lysate of acid phosphatase 5, tartrate resistant (ACP5), transcript variant 1 |
USD 325.00 |
|
LY426342 | Transient overexpression lysate of acid phosphatase 5, tartrate resistant (ACP5), transcript variant 3 |
USD 325.00 |
|
PH310752 | ACP5 MS Standard C13 and N15-labeled recombinant protein (NP_001602) |
USD 2,055.00 |
{0} Product Review(s)
Be the first one to submit a review