Nucleoside phosphorylase (PNP) (NM_000270) Human Mass Spec Standard

CAT#: PH310759

PNP MS Standard C13 and N15-labeled recombinant protein (NP_000261)

Product Images

Coomassie blue staining of purified PNP protein (Cat# TP310759). The protein was produced from HEK293T cells transfected with PNP cDNA clone (Cat# RC210759) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC210759
• Predicted MW: 32.1 kDa
• Protein Sequence:
  Sequence Link

  >RC210759 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MENGYTYEDYKNTAEWLLSHTKHRPQVAIICGSGLGGLTDKLTQAQIFDYGEIPNFPRSTVPGHAGRLVF
  GFLNGRACVMMQGRFHMYEGYPLWKVTFPVRVFHLLGVDTLVVTNAAGGLNPKFEVGDIMLIRDHINLPG
  FSGQNPLRGPNDERFGDRFPAMSDAYDRTMRQRALSTWKQMGEQRELQEGTYVMVAGPSFETVAECRVLQ
  KLGADAVGMSTVPEVIVARHCGLRVFGFSLITNKVIMDYESLEKANHEEVLAAGKQAAQKLEQFVSILMA
  SIPLPDKAS
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_000261
• RefSeq Size: 2438
• RefSeq ORF: 867
• Synonyms: NP; PRO1837; PUNP
• Locus ID: 4860
• UniProt ID: P00491, V9HWH6
• Cytogenetics: 14q11.2
• Summary: 'This gene encodes an enzyme which reversibly catalyzes the phosphorolysis of purine nucleosides. The enzyme is trimeric, containing three identical subunits. Mutations which result in nucleoside phosphorylase deficiency result in defective T-cell (cell-mediated) immunity but can also affect B-cell immunity and antibody responses. Neurologic disorders may also be apparent in patients with immune defects. A known polymorphism at aa position 51 that does not affect enzyme activity has been described. A pseudogene has been identified on chromosome 2. [provided by RefSeq, Jul 2008]'
• Protein Families: Druggable Genome, Stem cell - Pluripotency
• Protein Pathways: Metabolic pathways, Nicotinate and nicotinamide metabolism, Purine metabolism, Pyrimidine metabolism