COX19 (NM_001031617) Human Mass Spec Standard
CAT#: PH310770
COX19 MS Standard C13 and N15-labeled recombinant protein (NP_001026788)
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC210770 |
Predicted MW | 10.4 kDa |
Protein Sequence |
>RC210770 protein sequence
Red=Cloning site Green=Tags(s) MSTAMNFGTKSFQPRPPDKGSFPLDHLGECKSFKEKFMKCLHNNNFENALCRKESKEYLECRMERKLMLQ EPLEKLGFGDLTSGKSEAKK myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | 50 ug/ml as determined by BCA |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_001026788 |
RefSeq Size | 4896 |
RefSeq ORF | 270 |
Locus ID | 90639 |
UniProt ID | Q49B96 |
Cytogenetics | 7p22.3 |
Summary | COX19 encodes a cytochrome c oxidase (COX)-assembly protein. The S. cerevisiae Cox19 protein may play a role in metal transport to the mitochondrial intermembrane space and assembly of complex IV of the mitochondrial respiratory chain (Sacconi et al., 2005 [PubMed 16212937]). [supplied by OMIM, Mar 2008] |
Documents
FAQs |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC422214 | COX19 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LY422214 | Transient overexpression lysate of COX19 cytochrome c oxidase assembly homolog (S. cerevisiae) (COX19) |
USD 396.00 |
|
TP310770 | Recombinant protein of human COX19 cytochrome c oxidase assembly homolog (S. cerevisiae) (COX19) |
USD 823.00 |
{0} Product Review(s)
Be the first one to submit a review