COX19 (NM_001031617) Human Mass Spec Standard

CAT#: PH310770

COX19 MS Standard C13 and N15-labeled recombinant protein (NP_001026788)

Product Images

Coomassie blue staining of purified COX19 protein (Cat# TP310770). The protein was produced from HEK293T cells transfected with COX19 cDNA clone (Cat# RC210770) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC210770
• Predicted MW: 10.4 kDa
• Protein Sequence:
  Sequence Link

  >RC210770 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MSTAMNFGTKSFQPRPPDKGSFPLDHLGECKSFKEKFMKCLHNNNFENALCRKESKEYLECRMERKLMLQ
  EPLEKLGFGDLTSGKSEAKK
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_001026788
• RefSeq Size: 4896
• RefSeq ORF: 270
• Locus ID: 90639
• UniProt ID: Q49B96
• Cytogenetics: 7p22.3
• Summary: COX19 encodes a cytochrome c oxidase (COX)-assembly protein. The S. cerevisiae Cox19 protein may play a role in metal transport to the mitochondrial intermembrane space and assembly of complex IV of the mitochondrial respiratory chain (Sacconi et al., 2005 [PubMed 16212937]). [supplied by OMIM, Mar 2008]