COX19 (NM_001031617) Human Recombinant Protein

CAT#: TP310770

Recombinant protein of human COX19 cytochrome c oxidase assembly homolog (S. cerevisiae) (COX19)

Product Images

Coomassie blue staining of purified COX19 protein (Cat# TP310770). The protein was produced from HEK293T cells transfected with COX19 cDNA clone (Cat# RC210770) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC210770 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MSTAMNFGTKSFQPRPPDKGSFPLDHLGECKSFKEKFMKCLHNNNFENALCRKESKEYLECRMERKLMLQ
  EPLEKLGFGDLTSGKSEAKK
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 10.2 kDa
• Concentration: >50 ug/mL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_001026788
• Locus ID: 90639
• UniProt ID: Q49B96
• Cytogenetics: 7p22.3
• Refseq Size: 4896
• Refseq ORF: 270
• Summary: COX19 encodes a cytochrome c oxidase (COX)-assembly protein. The S. cerevisiae Cox19 protein may play a role in metal transport to the mitochondrial intermembrane space and assembly of complex IV of the mitochondrial respiratory chain (Sacconi et al., 2005 [PubMed 16212937]).[supplied by OMIM, Mar 2008]