NDUFC1 (NM_002494) Human Mass Spec Standard

CAT#: PH310771

NDUFC1 MS Standard C13 and N15-labeled recombinant protein (NP_002485)

Product Images

Coomassie blue staining of purified NDUFC1 protein (Cat# TP310771). The protein was produced from HEK293T cells transfected with NDUFC1 cDNA clone (Cat# RC210771) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC210771
• Predicted MW: 8.7 kDa
• Protein Sequence:
  Sequence Link

  >RC210771 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MAPSALLRPLSRLLAPARLPSGPSVRSKFYVREPPNAKPDWLKVGFTLGTTVFLWIYLIKQHNEDILEYK
  RRNGLE
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_002485
• RefSeq Size: 860
• RefSeq ORF: 228
• Synonyms: KFYI
• Locus ID: 4717
• UniProt ID: O43677
• Cytogenetics: 4q31.1
• Summary: 'The encoded protein is a subunit of the NADH:ubiquinone oxidoreductase (complex I), the first enzyme complex in the electron transport chain located in the inner mitochondrial membrane. Alternative splicing results in multiple transcript variants. [provided by RefSeq, May 2010]'
• Protein Pathways: Alzheimer's disease, Huntington's disease, Metabolic pathways, Oxidative phosphorylation, Parkinson's disease