LECT2 (NM_002302) Human Mass Spec Standard

CAT#: PH310790

LECT2 MS Standard C13 and N15-labeled recombinant protein (NP_002293)

Product Images

Coomassie blue staining of purified LECT2 protein (Cat# TP310790). The protein was produced from HEK293T cells transfected with LECT2 cDNA clone (Cat# RC210790) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC210790
• Predicted MW: 16.4 kDa
• Protein Sequence:
  Sequence Link

  >RC210790 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MFSTKALLLAGLISTALAGPWANICAGKSSNEIRTCDRHGCGQYSAQRSQRPHQGVDVLCSAGSTVYAPF
  TGMIVGQEKPYQNKNAINNGVRISGRGFCVKMFYIKPIKYKGPIKKGEKLGTLLPLQKVYPGIQSHVHIE
  NCDSSDPTAYL
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_002293
• RefSeq Size: 1077
• RefSeq ORF: 453
• Synonyms: chm-II; chm2
• Locus ID: 3950
• UniProt ID: O14960
• Cytogenetics: 5q31.1
• Summary: 'This gene encodes a secreted, 16 kDa protein that acts as a chemotactic factor to neutrophils and stimulates the growth of chondrocytes and osteoblasts. This protein has high sequence similarity to the chondromodulin repeat regions of the chicken myb-induced myeloid 1 protein. A polymorphism in this gene may be associated with rheumatoid arthritis. [provided by RefSeq, Jul 2008]'
• Protein Families: Druggable Genome, Secreted Protein