PACAP (ADCYAP1) (NM_001117) Human Mass Spec Standard

CAT#: PH310851

ADCYAP1 MS Standard C13 and N15-labeled recombinant protein (NP_001108)

Product Images

Coomassie blue staining of purified ADCYAP1 protein (Cat# TP310851). The protein was produced from HEK293T cells transfected with ADCYAP1 cDNA clone (Cat# RC210851) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC210851
• Predicted MW: 18.8 kDa
• Protein Sequence:
  Sequence Link

  >RC210851 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MTMCSGARLALLVYGIIMHSSVYSSPAAAGLRFPGIRPEEEAYGEDGNPLPDFDGSEPPGAGSPASAPRA
  AAAWYRPAGRRDVAHGILNEAYRKVLDQLSAGKHLQSLVARGVGGSLGGGAGDDAEPLSKRHSDGIFTDS
  YSRYRKQMAVKKYLAAVLGKRYKQRVKNKGRRIAYL
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_001108
• RefSeq Size: 3259
• RefSeq ORF: 528
• Synonyms: PACAP
• Locus ID: 116
• UniProt ID: P18509
• Cytogenetics: 18p11.32
• Summary: 'This gene encodes a secreted proprotein that is further processed into multiple mature peptides. These peptides stimulate adenylate cyclase and increase cyclic adenosine monophosphate (cAMP) levels, resulting in the transcriptional activation of target genes. The products of this gene are key mediators of neuroendocrine stress responses. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Feb 2013]'
• Protein Families: Secreted Protein