CD200R (CD200R1) (NM_170780) Human Mass Spec Standard

CAT#: PH310870

CD200R1 MS Standard C13 and N15-labeled recombinant protein (NP_740750)

Product Images

Coomassie blue staining of purified CD200R1 protein (Cat# TP310870). The protein was produced from HEK293T cells transfected with CD200R1 cDNA clone (Cat# RC210870) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC210870
• Predicted MW: 36.6 kDa
• Protein Sequence:
  Sequence Link

  >RC210870 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MLCPWRTANLGLLLILTIFLVAASSSLCMDEKQITQNYSKVLAEVNTSWPVKMATNAVLCCPPIALRNLI
  IITWEIILRGQPSCTKAYKKETNETKETNCTDERITWVSRPDQNSDLQIRTVAITHDGYYRCIMVTPDGN
  FHRGYHLQVLVTPEVTLFQNRNRTAVCKAVAGKPAAHISWIPEGDCATKQEYWSNGTVTVKSTCHWEVHN
  VSTVTCHVSHLTGNKSLYIELLPVPGAKKSAKLYIPYIILTIIILTIVGFIWLLKVNGCRKYKLNKTEST
  PVVEEDEMQPYASYTEKNNPLYDTTNKVKASEALQSEVDTDLHTL
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_740750
• RefSeq Size: 2203
• RefSeq ORF: 975
• Synonyms: CD200R; HCRTR2; MOX2R; OX2R
• Locus ID: 131450
• UniProt ID: Q8TD46
• Cytogenetics: 3q13.2
• Summary: This gene encodes a receptor for the OX-2 membrane glycoprotein. Both the receptor and substrate are cell surface glycoproteins containing two immunoglobulin-like domains. This receptor is restricted to the surfaces of myeloid lineage cells and the receptor-substrate interaction may function as a myeloid downregulatory signal. Mouse studies of a related gene suggest that this interaction may control myeloid function in a tissue-specific manner. Alternative splicing of this gene results in multiple transcript variants. [provided by RefSeq, Jul 2008]
• Protein Families: Druggable Genome, Transmembrane