CD200R (CD200R1) (NM_170780) Human Recombinant Protein

CAT#: TP310870

Recombinant protein of human CD200 receptor 1 (CD200R1), transcript variant 4

Product Images

Coomassie blue staining of purified CD200R1 protein (Cat# TP310870). The protein was produced from HEK293T cells transfected with CD200R1 cDNA clone (Cat# RC210870) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC210870 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MLCPWRTANLGLLLILTIFLVAASSSLCMDEKQITQNYSKVLAEVNTSWPVKMATNAVLCCPPIALRNLI
  IITWEIILRGQPSCTKAYKKETNETKETNCTDERITWVSRPDQNSDLQIRTVAITHDGYYRCIMVTPDGN
  FHRGYHLQVLVTPEVTLFQNRNRTAVCKAVAGKPAAHISWIPEGDCATKQEYWSNGTVTVKSTCHWEVHN
  VSTVTCHVSHLTGNKSLYIELLPVPGAKKSAKLYIPYIILTIIILTIVGFIWLLKVNGCRKYKLNKTEST
  PVVEEDEMQPYASYTEKNNPLYDTTNKVKASEALQSEVDTDLHTL
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 36.4 kDa
• Concentration: >50 ug/mL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_740750
• Locus ID: 131450
• UniProt ID: Q8TD46
• Cytogenetics: 3q13.2
• Refseq Size: 2203
• Refseq ORF: 975
• Synonyms: CD200R; HCRTR2; MOX2R; OX2R
• Summary: This gene encodes a receptor for the OX-2 membrane glycoprotein. Both the receptor and substrate are cell surface glycoproteins containing two immunoglobulin-like domains. This receptor is restricted to the surfaces of myeloid lineage cells and the receptor-substrate interaction may function as a myeloid downregulatory signal. Mouse studies of a related gene suggest that this interaction may control myeloid function in a tissue-specific manner. Alternative splicing of this gene results in multiple transcript variants. [provided by RefSeq, Jul 2008]
• Protein Families: Druggable Genome, Transmembrane