Macrophage Inflammatory Protein 3 (CCL23) (NM_145898) Human Mass Spec Standard

CAT#: PH310897

CCL23 MS Standard C13 and N15-labeled recombinant protein (NP_665905)

Product Images

Coomassie blue staining of purified CCL23 protein (Cat# TP310897). The protein was produced from HEK293T cells transfected with CCL23 cDNA clone (Cat# RC210897) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC210897
• Predicted MW: 13.4 kDa
• Protein Sequence:
  Sequence Link

  >RC210897 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MKVSVAALSCLMLVTALGSQARVTKDAETEFMMSKLPLENPVLLDRFHATSADCCISYTPRSIPCSLLES
  YFETNSECSKPGVIFLTKKGRRFCANPSDKQVQVCMRMLKLDTRIKTRKN
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_665905
• RefSeq Size: 604
• RefSeq ORF: 360
• Synonyms: CK-BETA-8; Ckb-8; Ckb-8-1; CKb8; hmrp-2a; MIP-3; MIP3; MPIF-1; SCYA23
• Locus ID: 6368
• UniProt ID: P55773
• Cytogenetics: 17q12
• Summary: 'This gene is one of several chemokine genes clustered on the q-arm of chromosome 17. Chemokines form a superfamily of secreted proteins involved in immunoregulatory and inflammatory processes. The superfamily is divided into four subfamilies based on the arrangement of the N-terminal cysteine residues of the mature peptide. This chemokine, a member of the CC subfamily, displays chemotactic activity on resting T lymphocytes and monocytes, lower activity on neutrophils and no activity on activated T lymphocytes. The protein is also a strong suppressor of colony formation by a multipotential hematopoietic progenitor cell line. In addition, the product of this gene is a potent agonist of the chemokine (C-C motif) receptor 1. Alternative splicing results in multiple transcript variants that encode different isoforms. [provided by RefSeq, Jul 2013]'
• Protein Families: Druggable Genome, Secreted Protein
• Protein Pathways: Chemokine signaling pathway, Cytokine-cytokine receptor interaction