Macrophage Inflammatory Protein 3 (CCL23) (NM_145898) Human Recombinant Protein
CAT#: TP310897
Recombinant protein of human chemokine (C-C motif) ligand 23 (CCL23), transcript variant CKbeta8
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC210897 protein sequence
Red=Cloning site Green=Tags(s) MKVSVAALSCLMLVTALGSQARVTKDAETEFMMSKLPLENPVLLDRFHATSADCCISYTPRSIPCSLLES YFETNSECSKPGVIFLTKKGRRFCANPSDKQVQVCMRMLKLDTRIKTRKN myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 11.3 kDa |
Concentration | >50 ug/mL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_665905 |
Locus ID | 6368 |
UniProt ID | P55773 |
Cytogenetics | 17q12 |
Refseq Size | 604 |
Refseq ORF | 360 |
Synonyms | CK-BETA-8; Ckb-8; Ckb-8-1; CKb8; hmrp-2a; MIP-3; MIP3; MPIF-1; SCYA23 |
Summary | This gene is one of several chemokine genes clustered on the q-arm of chromosome 17. Chemokines form a superfamily of secreted proteins involved in immunoregulatory and inflammatory processes. The superfamily is divided into four subfamilies based on the arrangement of the N-terminal cysteine residues of the mature peptide. This chemokine, a member of the CC subfamily, displays chemotactic activity on resting T lymphocytes and monocytes, lower activity on neutrophils and no activity on activated T lymphocytes. The protein is also a strong suppressor of colony formation by a multipotential hematopoietic progenitor cell line. In addition, the product of this gene is a potent agonist of the chemokine (C-C motif) receptor 1. Alternative splicing results in multiple transcript variants that encode different isoforms. [provided by RefSeq, Jul 2013] |
Protein Families | Druggable Genome, Secreted Protein |
Protein Pathways | Chemokine signaling pathway, Cytokine-cytokine receptor interaction |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC407835 | CCL23 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 99.00 |
|
LY407835 | Transient overexpression lysate of chemokine (C-C motif) ligand 23 (CCL23), transcript variant CKbeta8 |
USD 325.00 |
|
PH310897 | CCL23 MS Standard C13 and N15-labeled recombinant protein (NP_665905) |
USD 2,055.00 |
|
TP720600 | Purified recombinant protein of Human chemokine (C-C motif) ligand 23 (CCL23), transcript variant CKbeta8 |
USD 300.00 |
|
TP723312 | Purified recombinant protein of Human chemokine (C-C motif) ligand 23 (CCL23), transcript variant CKbeta8. |
USD 240.00 |
|
TP723835 | Purified recombinant protein of Human chemokine (C-C motif) ligand 23 (CCL23 / MPIF-1), transcript variant CKbeta8 |
USD 205.00 |
|
TP723836 | Purified recombinant protein of Human chemokine (C-C motif) ligand 23 (CCL23 / MPIF-1), transcript variant CKbeta8 |
USD 205.00 |
{0} Product Review(s)
Be the first one to submit a review