CD10 (MME) (NM_007288) Human Mass Spec Standard
CAT#: PH310961
MME MS Standard C13 and N15-labeled recombinant protein (NP_009219)
Specifications
| Product Data | |
| Tag | C-Myc/DDK |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC210961 |
| Predicted MW | 85.5 kDa |
| Protein Sequence |
>RC210961 protein sequence
Red=Cloning site Green=Tags(s) MGKSESQMDITDINTPKPKKKQRWTPLEISLSVLVLLLTIIAVTMIALYATYDDGICKSSDCIKSAARLI QNMDATTEPCTDFFKYACGGWLKRNVIPETSSRYGNFDILRDELEVVLKDVLQEPKTEDIVAVQKAKALY RSCINESAIDSRGGEPLLKLLPDIYGWPVATENWEQKYGASWTAEKAIAQLNSKYGKKVLINLFVGTDDK NSVNHVIHIDQPRLGLPSRDYYECTGIYKEACTAYVDFMISVARLIRQEERLPIDENQLALEMNKVMELE KEIANATAKPEDRNDPMLLYNKMTLAQIQNNFSLEINGKPFSWLNFTNEIMSTVNISITNEEDVVVYAPE YLTKLKPILTKYSARDLQNLMSWRFIMDLVSSLSRTYKESRNAFRKALYGTTSETATWRRCANYVNGNME NAVGRLYVEAAFAGESKHVVEDLIAQIREVFIQTLDDLTWMDAETKKRAEEKALAIKERIGYPDDIVSND NKLNNEYLELNYKEDEYFENIIQNLKFSQSKQLKKLREKVDKDEWISGAAVVNAFYSSGRNQIVFPAGIL QPPFFSAQQSNSLNYGGIGMVIGHEITHGFDDNGRNFNKDGDLVDWWTQQSASNFKEQSQCMVYQYGNFS WDLAGGQHLNGINTLGENIADNGGLGQAYRAYQNYIKKNGEEKLLPGLDLNHKQLFFLNFAQVWCGTYRP EYAVNSIKTDVHSPGNFRIIGTLQNSAEFSEAFHCRKNSYMNPEKKCRVW myc-FLAG tag |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | 50 ug/ml as determined by BCA |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions. |
| Reference Data | |
| RefSeq | NP_009219 |
| RefSeq Size | 5665 |
| RefSeq ORF | 2250 |
| Synonyms | CALLA; CD10; CMT2T; NEP; SCA43; SFE |
| Locus ID | 4311 |
| UniProt ID | P08473 |
| Cytogenetics | 3q25.2 |
| Summary | 'The protein encoded by this gene is a type II transmembrane glycoprotein and a common acute lymphocytic leukemia antigen that is an important cell surface marker in the diagnosis of human acute lymphocytic leukemia (ALL). The encoded protein is present on leukemic cells of pre-B phenotype, which represent 85% of cases of ALL. This protein is not restricted to leukemic cells, however, and is found on a variety of normal tissues. The protein is a neutral endopeptidase that cleaves peptides at the amino side of hydrophobic residues and inactivates several peptide hormones including glucagon, enkephalins, substance P, neurotensin, oxytocin, and bradykinin. [provided by RefSeq, Aug 2017]' |
| Protein Families | Druggable Genome, Protease, Transmembrane |
| Protein Pathways | Alzheimer's disease, Hematopoietic cell lineage, Renin-angiotensin system |
Documents
| FAQs |
Resources
Recombinant Protein Resources |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC400326 | MME HEK293T cell transient overexpression lysate (as WB positive control) |
USD 187.00 |
|
| LC416064 | MME HEK293T cell transient overexpression lysate (as WB positive control) |
USD 187.00 |
|
| LC416065 | MME HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
| LC416066 | MME HEK293T cell transient overexpression lysate (as WB positive control) |
USD 187.00 |
|
| LC425018 | MME HEK293T cell transient overexpression lysate (as WB positive control) |
USD 187.00 |
|
| LC429337 | MME HEK293T cell transient overexpression lysate (as WB positive control) |
USD 187.00 |
|
| LC429338 | MME HEK293T cell transient overexpression lysate (as WB positive control) |
USD 187.00 |
|
| LY400326 | Transient overexpression lysate of membrane metallo-endopeptidase (MME), transcript variant 1 |
USD 665.00 |
|
| LY416064 | Transient overexpression lysate of membrane metallo-endopeptidase (MME), transcript variant 1bis |
USD 665.00 |
|
| LY416065 | Transient overexpression lysate of membrane metallo-endopeptidase (MME), transcript variant 2a |
USD 436.00 |
|
| LY416066 | Transient overexpression lysate of membrane metallo-endopeptidase (MME), transcript variant 2b |
USD 665.00 |
|
| LY425018 | Transient overexpression lysate of membrane metallo-endopeptidase (MME), transcript variant 1 |
USD 605.00 |
|
| LY429337 | Transient overexpression lysate of membrane metallo-endopeptidase (MME), transcript variant 2a |
USD 605.00 |
|
| LY429338 | Transient overexpression lysate of membrane metallo-endopeptidase (MME), transcript variant 2b |
USD 605.00 |
|
| PH323013 | MME MS Standard C13 and N15-labeled recombinant protein (NP_000893) |
USD 2,055.00 |
|
| PH323061 | MME MS Standard C13 and N15-labeled recombinant protein (NP_009218) |
USD 2,055.00 |
|
| PH323116 | MME MS Standard C13 and N15-labeled recombinant protein (NP_009220) |
USD 2,055.00 |
|
| TP310961 | Recombinant protein of human membrane metallo-endopeptidase (MME), transcript variant 2a |
USD 788.00 |
|
| TP323013 | Recombinant protein of human membrane metallo-endopeptidase (MME), transcript variant 1 |
USD 748.00 |
|
| TP323061 | Recombinant protein of human membrane metallo-endopeptidase (MME), transcript variant 1bis |
USD 748.00 |
|
| TP323116 | Recombinant protein of human membrane metallo-endopeptidase (MME), transcript variant 2b |
USD 748.00 |
{0} Product Review(s)
Be the first one to submit a review
Germany
Japan
United Kingdom
China