ZSCAN4 (NM_152677) Human Mass Spec Standard

CAT#: PH311003

ZSCAN4 MS Standard C13 and N15-labeled recombinant protein (NP_689890)

Product Images

Coomassie blue staining of purified ZSCAN4 protein (Cat# TP311003). The protein was produced from HEK293T cells transfected with ZSCAN4 cDNA clone (Cat# RC211003) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC211003
• Predicted MW: 49 kDa
• Protein Sequence:
  Sequence Link

  >RC211003 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MALDLRTIFQCEPSENNLGSENSAFQQSQGPAVQREEGISEFSRMVLNSFQDSNNSYARQELQRLYRIFH
  SWLQPEKHSKDEIISLLVLEQFMIGGHCNDKASVKEKWKSSGKNLERFIEDLTDDSINPPALVHVHMQGQ
  EALFSEDMPLRDVIVHLTKQVNAQTTREANMGTPSQTSQDTSLETGQGYEDEQDGWNSSSKTTRVNENIT
  NQGNQIVSLIIIQEENGPRPEEGGVSSDNPYNSKRAELVTARSQEGSINGITFQGVPMVMGAGCISQPEQ
  SSPESALTHQSNEGNSTCEVHQKGSHGVQKSYKCEECPKVFKYLCHLLAHQRRHRNERPFVCPECQKGFF
  QISDLRVHQIIHTGKKPFTCSMCKKSFSHKTNLRSHERIHTGEKPYTCPFCKTSYRQSSTYHRHMRTHEK
  ITLPSVPSTPEAS
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_689890
• RefSeq Size: 2260
• RefSeq ORF: 1299
• Synonyms: ZNF494
• Locus ID: 201516
• UniProt ID: Q8NAM6
• Cytogenetics: 19q13.43
• Summary: The ZSCAN4 gene encodes a protein involved in telomere maintenance and with a key role in the critical feature of mouse embryonic stem (ES) cells, namely, defying cellular senescence and maintaining normal karyotype for many cell divisions in culture (Zalzman et al., 2010 [PubMed 20336070]). [supplied by OMIM, May 2010]
• Protein Families: Transcription Factors