IL17C (NM_013278) Human Mass Spec Standard

CAT#: PH311039

IL17C MS Standard C13 and N15-labeled recombinant protein (NP_037410)

Product Images

Coomassie blue staining of purified IL17C protein (Cat# TP311039). The protein was produced from HEK293T cells transfected with IL17C cDNA clone (Cat# RC211039) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC211039
• Predicted MW: 21.8 kDa
• Protein Sequence:
  Sequence Link

  >RC211039 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MTLLPGLLFLTWLHTCLAHHDPSLRGHPHSHGTPHCYSAEELPLGQAPPHLLARGAKWGQALPVALVSSL
  EAASHRGRHERPSATTQCPVLRPEEVLEADTHQRSISPWRYRVDTDEDRYPQKLAFAECLCRGCIDARTG
  RETAALNSVRLLQSLLVLRRRPCSRDGSGLPTPGAFAFHTEFIHVPVGCTCVLPRSV
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_037410
• RefSeq Size: 1048
• RefSeq ORF: 591
• Synonyms: CX2; IL-17C
• Locus ID: 27189
• UniProt ID: Q9P0M4
• Cytogenetics: 16q24.2
• Summary: The protein encoded by this gene is a T cell-derived cytokine that shares the sequence similarity with IL17. This cytokine was reported to stimulate the release of tumor necrosis factor alpha and interleukin 1 beta from a monocytic cell line. The expression of this cytokine was found to be restricted to activated T cells. [provided by RefSeq, Jul 2008]
• Protein Families: Druggable Genome, Secreted Protein